Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25000-AT4G31800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):WRKY DNA-binding protein 60
Function (paralog2):WRKY DNA-binding protein 18

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.8240040393696
Log2 mRNA fold difference:0.91348139516715
Log2 TE fold difference:0.94051214367785
Sequences
Protein sequence

MDYDPNTNPFDLHFSGKLPKREVSASASKVVEKKWLVKDEKRNMLQDEINRVNSENKKLT
EMLARVCEKYYALNNLMEELQSRKSPESVNFQNKQLTGKRKQELDEFVSSPIGLSLGPIE
NITNDKATVSTAYFAAEKSDTSLTVKDGYQWRKYGQKITRDNPSPRAYFRCSFSPSCLVK
KKVQRSAEDPSFLVATYEGTHNHTGPHASVSRTVKLDLVQGGLEPVEEKKERGTIQEVLV
QQMASSLTKDPKFTAALATAISGRLIEHSRT

MDGSSFLDISLDLNTNPFSAKLPKKEVSVLASTHLKRKWLEQDESASELREELNRVNSEN
KKLTEMLARVCESYNELHNHLEKLQSRQSPEIEQTDIPIKKRKQDPDEFLGFPIGLSSGK
TENSSSNEDHHHHHQQHEQKNQLLSCKRPVTDSFNKAKVSTVYVPTETSDTSLTVKDGFQ
WRKYGQKVTRDNPSPRAYFRCSFAPSCPVKKKVQRSAEDPSLLVATYEGTHNHLGPNASE
GDATSQGGSSTVTLDLVNGCHRLALEKNERDNTMQEVLIQQMASSLTKDSKFTAALAAAI
SGRLMEQSRT

www.000webhost.com

Other information
Ka divergence:-0.175229KaKs divergence:-0.844323
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):816Length 2 (bp):933Length divergence:0.067
MFE 1 (kcal):-226.22MFE 2 (kcal):-265.39MFE divergence0.08