Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25060-AT4G31840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):early nodulin-like protein 14
Function (paralog2):early nodulin-like protein 15

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.48073991045908
Log2 mRNA fold difference:-0.38460182006756
Log2 TE fold difference:0.84067760467021
Sequences
Protein sequence

MFLSASMASSSLHVAIFSLIFLFSLAAANEVTVGGKSGDWKIPPSSSYSFTEWAQKARFK
VGDFIVFRYESGKDSVLEVTKEAYNSCNTTNPLANYTDGETKVKLDRSGPFYFISGANGH
CEKGQKLSLVVISPRHSVISPAPSPVEFEDGPALAPAPISGSVRLGGCYVVLGLVLGLCA
WF

MASSSLLVTIFLCISVFFFSSVNANEVTVGGKSGDWKIPPSSSFSFNEWAQKARFKVGDF
IVFKYEAGKDSVLQVTREAYEKCNTTSPKASYTDGNTKVKLDQAGPVYFVSGTEGHCQKG
QKLRLVVITPRNSAFSPGPSPSEFDGPAVAPTSGAAKLAGGFSVVFGLVLGLWAFFF

www.000webhost.com

Other information
Ka divergence:0.0871684KaKs divergence:-0.145585
GC content 1 (%):46GC content 2 (%):49GC content divergence:0.032
Length 1 (bp):549Length 2 (bp):534Length divergence:-0.014
MFE 1 (kcal):-157.2MFE 2 (kcal):-163.02MFE divergence0.018