Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25070-AT4G31860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein phosphatase 2C family protein
Function (paralog2):Protein phosphatase 2C family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.3880525065076
Log2 mRNA fold difference:-0.58234208005275
Log2 TE fold difference:-0.74429838714741
Sequences
Protein sequence

MGTYLSSPKTEKLSEDGENDKLRFGLSSMQGWRATMEDAHAAILDLDDKTSFFGVYDGHG
GKVVAKFCAKYLHQQVISNEAYKTGDVETSLRRAFFRMDDMMQGQRGWRELAVLGDKMNK
FSGMIEGFIWSPRSGDTNNQPDSWPLEDGPHSDFTGPTSGCTACVALIKDKKLFVANAGD
SRCVISRKSQAYNLSKDHKPDLEVEKERILKAGGFIHAGRINGSLNLTRAIGDMEFKQNK
FLPSEKQMVTADPDINTIDLCDDDDFLVVACDGIWDCMSSQELVDFIHEQLKSETKLSTV
CEKVVDRCLAPDTATGEGCDNMTIILVQFKKPNPSETEPEDSKPEPSEDEPSSSS

MGIYLSTPKTDKFSEDGENHKLRYGLSSMQGWRASMEDAHAAILDLDDNTSFLGVYDGHG
GKVVSKFCAKYLHQQVLSDEAYAAGDVGTSLQKAFFRMDEMMQGQRGWRELAVLGDKINK
FSGMIEGLIWSPRSGDSANKPDAWAFEEGPHSDFAGPNSGSTACVAVVRDKQLFVANAGD
SRCVISRKNQAYNLSRDHKPDLEAEKERILKAGGFIHAGRVNGSLNLSRAIGDMEFKQNK
FLPSEKQIVTASPDVNTVELCDDDDFLVLACDGIWDCMTSQQLVDFIHEQLNSETKLSVV
CEKVLDRCLAPNTSGGEGCDNMTMILVRFKNPTPSETELKPEASQAEGNHDEPSSSN

www.000webhost.com

Other information
Ka divergence:-0.434088KaKs divergence:-0.0805768
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1068Length 2 (bp):1074Length divergence:0.003
MFE 1 (kcal):-315.62MFE 2 (kcal):-312MFE divergence-0.006