Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25130-AT4G31890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARM repeat superfamily protein
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.2467935041312
Log2 mRNA fold difference:4.139630154502
Log2 TE fold difference:-1.6886196092173
Sequences
Protein sequence

MAKCHRNNVDPLILHRIPSASSSSLSGNTFSGSSLRRIIFDAISCGGSSRYRRELREEDD
EGCSKSTIIGEDSMRKPEKLSDLLNLAVIESGVETKKKEETLEILKRVVKDLQAEAEAEA
EAAEKKIAAASEVRLLAKDDIEARVTLAMLGAIPPLVSMIDDESQSEDALIASLYALLNL
GIGNDVNKAAIVKAGVVHKMLKLVESSKPPNQAIAEAIVANFLGLSALDSNKPIIGSSGA
IIFLVKTLKNFEETSSSQAREDALRALYNLSIYHQNVSFILETDLIPFLLNTLGDMEVSE
RILAILTNVVSVPEGRKAIGEVVEAFPILVDVLNWNDSIKCQEKAVYILMLMAHKGYGDR
NAMIEAGIESSLLELTLVGSPLAQKRASRVLECLRVVDKGKQVSAPIYGTSSLGRERGHD
LRMTDERKAVKQLVQQSLQSNMKRIVKRANLPHDFVTTSQHFSKSLTF

MAKCHRNNIGSLILDRAPSTSSSSTSGYHFRLWSTFSRSTFRRKIVDAVSCGGSSRYRHE
LREEDDEGSYVTVTAKSTVASSKDAKANTIGAALNGVAFEETSKKSEKLCDLLNLAEVEA
DVETMKKEEALEVLKRVVRELQSAAAAREDNDDGGDCRKKITAASEVRLLAKEDSEARVT
LAMLGAIPPLVSMIDDSRIVDAQIASLYALLNLGIGNDANKAAIVKAGAVHKMLKLIESP
NTPDQEIAEAVVANFLGLSALDSNKPIIGSSGAIIFLVKTLQNLDETSSSQAREDALRAL
YNLSIYQPNVSFILETDLITYLLNTLGDMEVSERILAILSNLVAVPEGRKAIGLVCDAFP
VLVDVLNWTDSPGCQEKATYILMLMAHKGYGDRQVMIEAGIESALLELTLLGSALAQKRA
SRILECLRVDKGKQVLDSTGSCGALSAPIYGTRDNGLDHEENDLMMSEERKAVKQLVQQS
LQSNMKRIVKRANLPQDFVPSEHFKSLSLSSTSKSLPF

www.000webhost.com

Other information
Ka divergence:-0.347225KaKs divergence:0.0244321
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1407Length 2 (bp):1557Length divergence:0.051
MFE 1 (kcal):-446.42MFE 2 (kcal):-509.49MFE divergence0.066