Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25160-AT4G31970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cytochrome P450, family 82, subfamily F, polypeptide 1
Function (paralog2):cytochrome P450, family 82, subfamily C, polypeptide 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.2358898596517
Log2 mRNA fold difference:-2.2422715415513
Log2 TE fold difference:-0.63722003470542
Sequences
Protein sequence

MDLIMLFLLSALFIFPVLILIKSRLRPKNKKSTAPMVPGAWPLLGHLHLFDTVNPTHVTF
GAMADVYGPVFMAKLGSIKVMIINSKEVAKEIYTVHDKLLERPELTASKLLGYNDSFLTF
SPYGLYWREIRKIAVSELFSTSGVDMHMVSRAREADLAFRALYVRWEKRGKPKEGVLVDM
KQEFIDLTANISLMMVSGKRYFGENPNCEVKEARRCGKLIREFLDYFALFLLSDVAPVLG
FLDWKTKRGMKRTAKGLDKVAEGWIEEHKNKRSDHGRSENDYLDILIKILGQDKIPGLSD
THTKIKALCLNLVLAGSETAIVVLVWAVSLLLNNPHVLRKAQEELDSKIGKERVVEELDI
KDLVYLQAIVKETFRLYPPVPLVAYRAVVEDFDIAFCKCHVPAGTQLMVSAWKIHRDPNV
WSNPEQFEPERFLTSNRELDVGGQSYKFFPFGLGRRSCPAIPLGMRMVHYLLVRFLHSFD
LARPSSQDVDMTESNGLVNHKATPLEVNIIPRLHKSLYEVDHIGTDN

MDTSLFSLFVPILVFVFIALFKKSKKPKHVKAPAPSGAWPIIGHLHLLSGKEQLLYRTLG
KMADQYGPAMSLRLGSSETFVVSSFEVAKDCFTVNDKALASRPITAAAKHMGYDCAVFGF
APYSAFWREMRKIATLELLSNRRLQMLKHVRVSEISMVMQDLYSLWVKKGGSEPVMVDLK
SWLEDMSLNMMVRMVAGKRYFGGGSLSPEDAEEARQCRKGVANFFHLVGIFTVSDAFPKL
GWFDFQGHEKEMKQTGRELDVILERWIENHRQQRKVSGTKHNDSDFVDVMLSLAEQGKFS
HLQHDAITSIKSTCLALILGGSETSPSTLTWAISLLLNNKDMLKKAQDEIDIHVGRDRNV
EDSDIENLVYIQAIIKETLRLYPAGPLLGHREAIEDCTVAGYNVRRGTRMLVNVWKIQRD
PRVYMEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFL
QSFDVKTVMDMPVDMTESPGLTIPKATPLEILISPRLKEGLYV

www.000webhost.com

Other information
Ka divergence:-0.434099KaKs divergence:-0.100352
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1584Length 2 (bp):1572Length divergence:-0.004
MFE 1 (kcal):-499.11MFE 2 (kcal):-466.72MFE divergence-0.034