Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25180-AT4G31920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):response regulator 12
Function (paralog2):response regulator 10

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.1155171044417
Log2 mRNA fold difference:-0.84425542723824
Log2 TE fold difference:-0.24830107594685
Sequences
Protein sequence

MTVEQNLEALDQFPVGMRVLAVDDDQTCLKILESLLRHCQYHVTTTNQAQKALELLRENK
NKFDLVISDVDMPDMDGFKLLELVGLEMDLPVIMLSAHSDPKYVMKGVTHGACDYLLKPV
RIEELKNIWQHVVRSRFDKNRGSNNNGDKRDGSGNEGVGNSDQNNGKGNRKRKDQYNEDE
DEDRDDNDDSCAQKKQRVVWTVELHKKFVAAVNQLGYEKAMPKKILDLMNVEKLTRENVA
SHLQKFRLYLKRISGVANQQAIMANSELHFMQMNGLDGFHHRPIPVGSGQYHGGAPAMRS
FPPNGILGRLNTPSGIGVRSLSSPPAGMFLQNQTDIGKFHHVSSLPLNHSDGGNILQGLP
MPLEFDQLQTNNNKSRNMNSNKSIAGTSMAFPSFSTQQNSLISAPNNNVVVLEGHPQATP
PGFPGHQINKRLEHWSNAVSSSTHPPPPAHNSNSINHQFDVSPLPHSRPDPLEWNNVSSS
YSIPFCDSANTLSSPALDTTNPRAFCRNTDFDSNTNVQPGVFYGPSTDAMALLSSSNPKE
GFVVGQQKLQSGGFMVADAGSLDDIVNSTMKQEQSQGDLSGGDLGYGGFSSLRTCI

MTMEQEIEVLDQFPVGMRVLAVDDDQTCLRILQTLLQRCQYHVTTTNQAQTALELLRENK
NKFDLVISDVDMPDMDGFKLLELVGLEMDLPVIMLSAHSDPKYVMKGVKHGACDYLLKPV
RIEELKNIWQHVVRKSKLKKNKSNVSNGSGNCDKANRKRKEQYEEEEEEERGNDNDDPTA
QKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKK
VSDDAIQQANRAAIDSHFMQMNSQKGLGGFYHHHRGIPVGSGQFHGGTTMMRHYSSNRNL
GRLNSLGAGMFQPVSSSFPRNHNDGGNILQGLPLEELQINNNINRAFPSFTSQQNSPMVA
PSNLLLLEGNPQSSSLPSNPGFSPHFEISKRLEHWSNAALSTNIPQSDVHSKPDTLEWNA
FCDSASPLVNPNLDTNPASLCRNTGFGSTNAAQTDFFYPLQMNQQPANNSGPVTEAQLFR
SSNPNEGLLMGQQKLQSGLMASDAGSLDDIVNSLMTQEQSQSDFSEGDWDLDGLAHSEHA
YEKLHFPFSLSA

Other information
Ka divergence:0.172134KaKs divergence:0.230085
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1791Length 2 (bp):1659Length divergence:-0.038
MFE 1 (kcal):-517.66MFE 2 (kcal):-496.62MFE divergence-0.021