Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25220-AT4G32000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.78270370403738
Log2 mRNA fold difference:-0.42175212201555
Log2 TE fold difference:-0.39545934614928
Sequences
Protein sequence

MIFITVSASSASNPSLAPVYSSMATFSPRIQMGSGEEDRFDAHKKLLIGLIISFSSLGLI
ILFCFGFWVYRKNQSPKSINNSGTFISNERICNKFQSLYVFNGSSNSESGNSFSLLMRRL
GSIKTQRRTSIQKGYVQFFDIKTLEKATGGFKESSVIGQGGFGCVYKGCLDNNVKAAVKK
IENVSQEAKREFQNEVDLLSKIHHSNVISLLGSASEINSSFIVYELMEKGSLDEQLHGPS
RGSALTWHMRMKIALDTARGLEYLHEHCRPPVIHRDLKSSNILLDSSFNAKISDFGLAVS
LDEHGKNNIKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVVLLELLLGRRPVEKLTPAQCQ
SLVTWAMPQLTDRSKLPNIVDAVIKDTMDLKHLYQVAAMAVLCVQPEPSYRPLITDVLHS
LVPLVPVELGGTLRLTR

MGKILHLLLLLLKVSVLEFIISVSAFTSPASQPSLSPVYTSMASFSPGIHMGKGQEHKLD
AHKKLLIALIITSSSLGLILVSCLCFWVYWSKKSPKNTKNSEGESRISLSKKGFVQSFDY
KTLEKATGGFKDGNLIGRGGFGDVYKACLGNNTLAAVKKIENVSQEAKREFQNEVDLLSK
IHHPNIISLFGYGNELSSSFIVYELMESGSLDTQLHGPSRGSALTWHMRMKIALDTARAV
EYLHERCRPPVIHRDLKSSNILLDSSFNAKISDFGLAVMVGAHGKNNIKLSGTLGYVAPE
YLLDGKLTDKSDVYAFGVVLLELLLGRRPVEKLSSVQCQSLVTWAMPQLTDRSKLPKIVD
PVIKDTMDHKHLYQVAAVAVLCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLIPSSS

Other information
Ka divergence:0.0150921KaKs divergence:0.12822
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1314Length 2 (bp):1260Length divergence:-0.021
MFE 1 (kcal):-358.3MFE 2 (kcal):-346.89MFE divergence-0.016