Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25250-AT4G32020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.0317807496812
Log2 mRNA fold difference:1.8723339577426
Log2 TE fold difference:0.9241516401086
Sequences
Protein sequence

MGVAVLHPHDSIINHFSTNTSPPLRHKKPITNRRRRSPSSHQSQISHPPPSPHNHTNHVR
ILKRGEDINVKIPIEKPDLKSNRQIGSDPMKISTPIRISNRKSMPALFYAGPVTSTSPPP
SEVPLPAFFANKTVAGFKPTDATNDLIKILRLDIA

MGVAVLNPQDCLKDPFSHMKQHRNPSACPNRQKKTVSNNRTRRSPPRSQSSRSSSPPVAP
PLPPPRAAVSAFVPKGTLKKSLSNTVAVSQVRILKRGEEIPKETSDLVVEMSDLGSTRRI
GPDPGLIPGQIRLSGRKSKSAPFYAGPVTMTSPPPSDVPLPAFFTKKATNDLIRILRLDI
A

Other information
Ka divergence:-0.703313KaKs divergence:0.999635
GC content 1 (%):46GC content 2 (%):52GC content divergence:0.061
Length 1 (bp):468Length 2 (bp):546Length divergence:0.077
MFE 1 (kcal):-107.61MFE 2 (kcal):-174.12MFE divergence0.236