Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25290-AT4G32070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein
Function (paralog2):Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.2376638284994
Log2 mRNA fold difference:2.4857764423128
Log2 TE fold difference:-0.23055833207492
Sequences
Protein sequence

MGKPTGKKKNNNYTEMPPTESSTTGGGKTGKSFDRSATKSFDDDMTIFINRALELKEEGN
KLFQKRDYEGAMFRYDKAVKLLPRDHGDVAYLRTSMASCYMQMGLGEYPNAINECNLALE
ASPRFSKALLKRARCYEALNKLDFAFRDSRVVLNMEPENVSANEIFERVKKVLVGKGIDV
DEMEKNLVNVQPVGAARLRKIVKERLRKKKKKSMTMTNGGNDGERKSVEAVVEDAKVDNG
EEVDSGRKGKAIEEKKLEDKVAVMDKEVIASEIKEDATVTRTVKLVHGDDIRWAQLPLDS
SVVLVRDVIKDRFPALKGFLIKYRDSEGDLVTITTTDELRLAASTREKLGSFRLYIAEVS
PNQEPTYDVIDNDESTDKFAKGSSSVADNGSVGDFVESEKASTSLEHWIFQFAQLFKNHV
GFDSDSYLELHNLGMKLYTEAMEDIVTGEDAQELFDIAADKFQEMAALAMFNWGNVHMSK
ARRQIYFPEDGSRETILEKVEAGFEWAKNEYNKAAEKYEGAVKIKSDFYEALLALGQQQF
EQAKLCWYHALSGEVDIESDASQDVLKLYNKAEESMEKGMQIWEEMEERRLNGISNFDKH
KELLQKLGLDGIFSEASDEESAEQTANMSSQINLLWGSLLYERSIVEYKLGLPTWDECLE
VAVEKFELAGASATDIAVMVKNHCSSDNALEGMGFKIDEIVQAWNEMYDAKRWQIGVPSF
RLEPLFRRRSPKLHDILENVFSGPQ

MGKPTAKKKNPETPKDASGGGGGGGGKSGKTYHRSTSRVFDEDMEIFISRALELKEEGNK
LFQKRDHEGAMLSFDKALKLLPKDHIDVAYLRTSMASCYMQMGLGEYPNAISECNLALEA
SPRYSKALVRRSRCYEALNKLDYAFRDARIVLNMEPGNVSANEIFDRVKKVLVDKGIDVD
EMEKDFVDVQPVCAARLKKIVKERLRKSKKKKKSGGKDEELKSPKVVVVDKGDEAEGRNK
PKEEKSDKSDIDGKIGGKREEKKTSFKSDKGQKKKSGGNKAGEERKVEDKVVVMDKEVIA
SEIVDGGGSKKEGATVTRTIKLVHGDDIRWAQLPLDSTVRLVRDVIRDRFPALRGFLIKY
RDTEGDLVTITTTDELRLAASTHDKLGSLRLYIAEVNPDQEPTYDGMSNTESTDKVSKRL
SSLADNGSVGEYVGSDKASGCFENWIFQFAQLFKNHVGFDSDSYVDLHDLGMKLYTEAME
DAVTGEDAQELFQIAADKFQEMGALALLNWGNVHMSKARKQVCIPEDASREAIIEAVEAA
FVWTQNEYNKAAEKYEEAIKVKPDFYEALLALGQEQFEHAKLCWYHALKSKVDLESEASQ
EVLKLYNKAEDSMERGMQIWEEMEECRLNGISKLDKHKNMLRKLELDELFSEASEEETVE
QTANMSSQINLLWGSLLYERSIVEYKLGLPTWDECLEVAVEKFELAGASATDIAVMVKNH
CSSESALEGNQFLARIPNSGQVTTQWFSVYNNLRTNAGMGFKIDEIVQAWNEMYDAKRWQ
MGVPSFRLEPMFRRRAPKLHDILENVFSGPV

www.000webhost.com

Other information
Ka divergence:0.141722KaKs divergence:0.143939
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2238Length 2 (bp):2436Length divergence:0.042
MFE 1 (kcal):-652.1MFE 2 (kcal):-714.86MFE divergence0.046