Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25300-AT4G32120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Galactosyltransferase family protein
Function (paralog2):Galactosyltransferase family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.80652806478018
Log2 mRNA fold difference:1.1223069897543
Log2 TE fold difference:-0.4144509405467
Sequences
Protein sequence

MESLPTTVPSKSERRARSSKFSQSSSKPSVIMAFFSCVAWLYVAGRLWQDAENRVVLNNI
LKKSYDQKPKVLTVDDKLMVLGCKDLERRIVETEMELTLAKSQGYLKNLKSGSSSGKKLL
AVIGVYSGFGSHLRRNTFRGSYMPQGDALRKLEERGIVIRFVIGRSPNRGDSLDRKIDEE
NQARKDFLILENHEEAQEELAKKVKFFFSAAVQNWDAEFYIKVDDNIDLDLEGLIGLLES
RRGQDAAYIGCMKSGEVVAEEGGKWYEPEWWKFGDEKSYFRHAAGSLLILSKTLAQYVNI
NSGSLKTYAFDDTSIGSWMIGVQATYIDDNRLCCSSIRQDKVCSVA

MESLPTTVSGKSDRRGRFSKSQNTSKPSLILAFFSCLAWLYVAGRLWQDAQYRAALNTVL
KMNYDQRPKVLTVEDKLVVLGCKDLERRIVETEMELAQAKSQGYLKKQKSVSSSGKKMLA
VIGVYTGFGSHLKRNKFRGSWMPRDDALKKLEERGVVIRFVIGRSANRGDSLDRKIDEEN
RATKDFLILENHEEAQEELPKKVKFFYSAAVQNWDAEFYVKVDDNVDLDLEGMIALLESR
RSQDGAYIGCMKSGDVITEEGSQWYEPEWWKFGDDKSYFRHATGSLVILSKNLAQYVNIN
SGLLKTYAFDDTTIGSWMIGVQATYIDDNRLCCSSTRQEKVCSMA

www.000webhost.com

Other information
Ka divergence:0.159728KaKs divergence:0.381651
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1041Length 2 (bp):1038Length divergence:-0.001
MFE 1 (kcal):-321.07MFE 2 (kcal):-315.87MFE divergence-0.008