Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25310-AT4G32130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF2012)
Function (paralog2):Protein of unknown function (DUF2012)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.34592395492735
Log2 mRNA fold difference:-1.0669949488645
Log2 TE fold difference:0.69069842272138
Sequences
Protein sequence

MTMTSIIRSSPTLAFIVLQICFIFFASTFPCSSGSEDSYTITGRVKIPPSNVIGHIAKFS
NVKVILNGGQKITFLRPDGYFTFHEVPAGTHLIEVSAMGYFFSPVRVDVSARHRGKVQAT
LTETRRSLTELVLEPLKEEQYYEIREPFNIMSIVKSPMGLMVGFMVVVVFLMPKLMENID
PEEMKQAQEEMRRQGVPSLTSLLPGAGASR

MAPIFRSTSLIAFSLFFFFFASTLPISSGSEDSYTITGRVRVPASTVIGHAAKFSNIKVI
LNGGQHVTFLRPDGYFTFHKVPAGTHLIEVYALGYFFSPVRVDVSARHRGKVQATLTETR
RSLTELVLEPLRAEQYYEMREPFSVMSIVKSPMGLMVGFMVVVVFLMPKLMENIDPEEMK
SAQEQMRSQGVPSLTSLLPASR

Other information
Ka divergence:0.0293301KaKs divergence:-0.237629
GC content 1 (%):44GC content 2 (%):47GC content divergence:0.033
Length 1 (bp):633Length 2 (bp):609Length divergence:-0.019
MFE 1 (kcal):-189.8MFE 2 (kcal):-186.95MFE divergence-0.008