Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25320-AT2G25330
Species:Arabidopsis
Duplication type:TD
Function (paralog1):TRAF-like family protein
Function (paralog2):TRAF-like family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.6464240839869
Log2 mRNA fold difference:-2.6239428165705
Log2 TE fold difference:0.97750665642534
Sequences
Protein sequence

MKQSSSEAVSSSSSSAAADQSHPSVSSSSSEKPLSSSSISPAEDLQVGSSRDGSGGAQEI
VAVDRPGEYSALCRWTVESFTRVKAKALWSKYFDVGGYDCRLLVYPRGDSQALPGYISIY
LQIMDPRGTTSSRWDCFASYRLSIVNLVDDSLTIHKDSWHRFSSKKKSHGWCDFTLNSSI
LDPKMGFLFNNDSLLITADILILNESVSFSRDNNNEGQSLYKENSIAGPMPDVLSGKFTW
KVNNFSLFKDMIKTQKIMSPVFPAGECNLRISVYQSVVNSQEYISMCLESKETEKTLVSD
RSCWCLFRMSALNQKPGCTHMHRDSYGRFAADNKSGDNTSLGWNDYMKMSEFVNPEAGFL
LDDMAVFSTSFHVIKEFSSFTKNGGLIGGRNGAGARKSDGHMGKFTWRIENFTRLKDLLK
KRKITGLCIKSKRFQIGNRDCRLIVYPRGQSQPPCHLSVFLEVTDSRSSSDWSCFVSHRL
SVVNQRLEEKSVTKESQNRYSKAAKDWGWREFVTLTSLFDQDSGFLVQDTVVFSAEVLIL
KETSATKEYVEADSTNSVSPTDNSVKKSSFTWKVENFLAFKEIMETRKIFSKFFQAGGCE
LRIGVYESFDTICIYLESDQSAGTDVDNNFWVKYKMGILNQKNPAKSVWKESSICTKTWN
NSVLQFMKVSDMLEADAGFLVRDTVVFVCEILDCCPWFEFSDLEVLASDDDQDALTTDPD
EIIDSEESEGISGDEEDTFRDFLSRAGFHLTFGENPSQPQVTLREKLLMDAGAIAGFLTG
LRVYLDDPTKVKRLLLPTKISCNDRSKLIKSDESSPSLMNLLMGVKVLQQAIIDLLLDIM
VECCQPSEEGSHSEPSLLSPKTDGCVAATSSESTRERGAAEPSQHLVDERFKSDTDATLS
TSAVPSSEMNGIDLLEKALAIEPMSPPTTSAGQSSDASVQSKTKWPEQSEELLGLIVNSL
KTLDAAVPQGCPEPRRRPHSAQKIALVLDRAPKHLQPDLVSLVPKLVEHSEHPLAALALI
ERLQKPEAEPALREPVYNALSQLECDSEVWEDILSQSFELLSDLNEESLVAAIHFTFKTA
SQCQHLPEAVNAVRERLKSLGADVSLCVLDYLSKTVHSWPGIAEMILRDINTDDSVGANF
ATLPCGPFLIGENETASEMADLMEEHIFYANRQFFDVYILLEMLSISCLAEEASQTFERA
VARGAIVAQAVAMVLEKQRVQSPNLNATSGDASLKHQDPVLEGEASEQPATGGTEFRIIL
NLAETLTHSRDPQVRGFVKMLYTILFKWFPDQPFRVQILRRLVDRFTSPTSSSHDLDLEL
EILAILIFQEQEVARPVLAMLKKVVEHANIDRAALWHQLRANKEELVRLKEEKKIEIQSM
TKEKSSITQKLSESEAANTRLKSEMKAEADRFSREKKDLVEQFRDVESQLEWIRSERQDE
IDKLSSEKKTLLDRLHEAETQLALQKTRKRDELKKVGKEKNALTEKLKVTEAARKRFEEE
LKRYATENVTREELRKSLEDQIRQLTQTVGQTKEEKREKEDQIARCEAYIDGMESKLQAC
QQYIHTLESSLREEISRHAPLYGANLESLSMKELDTIARIHEEGLRQIHALQQRKGHTLS
HGLPQGHTLYPTTPPQLPPMAIGLPPQLIPNGSGVHSNGHINGSVRPWFSHHT

MLSSSSSAADQSHPSISSEKPLSSSRDESGGAQEIVAVDRPGEYTALCRWTVESFTRVKA
KALWSKYFDVGGYDCRLLVYPRGDSQALPGSISIYLQIIDPRGTSSSLWDCFASYQLSII
NHVDDSLTIRKNSWHRFSNKKRSHGWCDFTLNSSVLDPKMGFLFNNDSLLITADIMILNE
SVSFSIDNNNESVVGSMTDVLSGTFTWTVENFSMFKEMIKTQKITSPVFVAGECFLRIGV
YQSVVNAQEYFSMCLDSTDTEKSVLSDKSSWCLFSMSALNQKHGCTNMNKESYGRFAADN
KSGDNTGLGWNDYMKMSDFVNPDAGYLLDDKAVFSTSFDVIKEFSSFTKNGTGNGYMGKF
SWRIENFTSLVDLLEKRKITGLYIKSKRFQIGNRDCRLIVYPRGQSQPPSHLSIFLEVTD
SRSSSSDWSCFVSHRLSVVNQRSEEKSVTKESQNRFSKAEKDWGWREFVTLTSLFDQDSG
FLVQDSVVFSVEVLMLKETSLTKDYTEAESASSVSQIDKTVKSSFTWKVENFLAFKGIME
KRKIFSKFFQAGGCELRIGVYESFDTICIYLESGQSAGNDVDNNLWVKYKMGILNQKNPA
KSVWKESSLCTKTWNNSVLLFMKVSDMLEADAGFLVRDTLVFVCEILDCCPWFEFSDLEV
LASDDVQDALTTNPDEVIGSEKSEEDTFRQVSP

www.000webhost.com

Other information
Ka divergence:0.707KaKs divergence:0.639657
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):5022Length 2 (bp):2082Length divergence:-0.414
MFE 1 (kcal):-1576.22MFE 2 (kcal):-649.42MFE divergence-0.416