Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25340-AT4G32150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):vesicle-associated membrane protein 712
Function (paralog2):vesicle-associated membrane protein 711

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.3671000925735
Log2 mRNA fold difference:7.4902422471928
Log2 TE fold difference:-2.9890202679113
Sequences
Protein sequence

MSILYALVARGTVVLAELSTTSTNASTIAKQILEKIPGNGDSHVSYSQDRYVFHVKRTDG
LTVLCMADEDAGRRIPFSFLEDIHQRFVRTYGRAIHSAQAYAMNDEFSRVLNQQIEYYSN
DPNADTISRIKGEMNQVRDVMIENIDNILDRGERLELLVDKTANMQGNTFRFRKQTRRFN
NTVWWRNCKLTLLLILVLLVIIYIGVAFACHGPTLPSCV

MAILYALVARGTVVLSEFTATSTNASTIAKQILEKVPGDNDSNVSYSQDRYVFHVKRTDG
LTVLCMAEETAGRRIPFAFLEDIHQRFVRTYGRAVHTALAYAMNEEFSRVLSQQIDYYSN
DPNADRINRIKGEMNQVRGVMIENIDKVLDRGERLELLVDKTANMQGNTFRFRKQARRFR
SNVWWRNCKLTVLLILLLLVIIYIAVAFLCHGPTLPSCI

Other information
Ka divergence:-0.187883KaKs divergence:-0.524197
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):660Length 2 (bp):660Length divergence:0
MFE 1 (kcal):-193.99MFE 2 (kcal):-200.17MFE divergence0.016