Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25350-AT4G32160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phox (PX) domain-containing protein
Function (paralog2):Phox (PX) domain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1604302799293
Log2 mRNA fold difference:0.0011679222925752
Log2 TE fold difference:0.60184392156231
Sequences
Protein sequence

MQRRSPPKHRHDGASPLPLGMDWSPPPRNWNGRDTIWPHDFRTGWSYCVTIPSWTLLSKS
KNSDPIVFYRVQVSVQSPEGVSTMRGILRRFNDFVKLLADLKRAFPRKSFPSAPPKGFLR
VKSRDMLEERRCSLEDWMTKLLSDIELARSVVVASFLELEATARSACQVVDQNASDSNDD
GNSTSLSSLVHPNSGGSSLLSSDYGSDTAYETSELGSASLGQDDVSETDTGDLTLDEDLT
NPTEKLVKFSMSNIDEGLSMSQTIIEQLEDFPKHRVHLGYANDITETNSYNGKASKGVFR
ANNDLRCRSESETSHSVMHDRKLSLESADGVSLLAGETSTSSILSSIVHSQLDVNHDISV
GNLEIPGNGRIVLPLKMHSKLNRILLTMNERLLNSKTDMEDLIARLNQETAVKEYLNRKV
DDLEVELETTKQRNKENLEQALMTERQSVTKMQWDMEELRQKTFEMELKLKSKEDGSSDS
KTSGNSTISESHELLQEMDATKQQLEDLSRRYVELEAKSKADIKVLVREVKSLRRSHMEM
EKELTRSLTEKSDTEKLLQQERIIVENTLEARRRLYSDCEILHDRLKVNNTNLSMDESSN
NREDLSEVSNALQDQIEAQLLLGFDETASEDELRKIMADMYED

MMQRRSPPKHRHDGTSPLPLGMDWSPPPRKWNGRDTVWPHDPRTGWSYCVTIPSWIVLPK
SRNSDPVVFYRVQVSVQSPEGITTMRGVLRRFNDFLKLLTDLKRTFPRKGFPSAPPKGLL
RMKSRAVLEERRCSLEEWITKLLSDIELARSVVVASFLELEAAARSACQDVDQNASDSNN
DRSSTSSSPMVHPSLSLFHAGGSTLTSDYGSDTAYETSEVGSPSVGQDDISEIGTEDLTL
DEDLTLTNPIEKLVNFSMSNIDEGLSMSETILEQLEDFPKHKVRSRYVNNILGKDVYNGN
ASKGVFLANNGSRLLSEPEPSTHSVMHDRNDSAERFALHTGQTSTSGLLISSRDSHLDLR
QGPGVSLGTGLVCNPERQGSAQIVLPLELRNKLNRILLATNERLVNAKTDMEDLIARLNQ
EIAVKDYLNKKVNDLEGELETTKQRSKENLEQAIMSERERFNQMQWDMEELRQKSYEMEM
KLKSREDGSSHAEPTVQSTISEKHVLSKELDARKQQLEDLSRRYEELEAKSKADMKVLVK
EVKSLRRSHVELEKELTHSLTDKTNAEKLLQEERKLLENTVAARKKLLSDCRILHDRLKE
YNLNLSMDGNGNFVDDSTTISDVLRLLSISDDQIEEAQLLSGFDENAAAEDIDKTLSMDT
ETRIMEDELRKILANIFVENAKLRKQVNSAMLRALQKDVKTTEDVNEENSDEKDEASRET
LKR

www.000webhost.com

Other information
Ka divergence:-0.340392KaKs divergence:-0.364208
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1932Length 2 (bp):2172Length divergence:0.058
MFE 1 (kcal):-557.51MFE 2 (kcal):-603.5MFE divergence0.04