Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25480-AT4G32330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TPX2 (targeting protein for Xklp2) protein family
Function (paralog2):TPX2 (targeting protein for Xklp2) protein family

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.9105808204274
Log2 mRNA fold difference:2.3967983723675
Log2 TE fold difference:-0.38864676661399
Sequences
Protein sequence

MDSESVVAADGADCAIANGEVTMEGDSSNGNGGTSENLECCSTQHPMEASEGTQNEQVDD
SKQMRGQKVQGRVKHEKTSGGKNIPSVLVKKKKDGKVVASNGSVAPNVKPVKSPKSKSLN
GREAHVTKHGNHDSLPAEGTRDKPKLRETRKQVNDTSEDDTQYPKEDDGKPRRASALPNY
GFSFRCDQRAEKRREFYSKLEEKIHAKEEEKNTVQAKSKETQEAELKMLRKSLNFKATPM
PTFYQEPQLPKTELKKIAITRPKSPKLGRKKTNSRADSEEAITIQTPRFGRLSLDEKTPK
DNPVVEGSVPGETKKPPVRKSLPRLPSEKTNLSNGKVAPAKAVTASTKAKSERKKPDKDV
DDLSQSSPVDDNADPEDSQEQAPRVNEDRNESHMVVEVVAVEP

MDPESIMAADGTDSAPANGGLAMENVCVKENGAVSVETVDTTSESQNENSANSSTLDTIE
HVKEAAEGTQVEHVDDSKCMKGEKAQRKPRHEKLSGGKNNSSVHIKKSKEGKSADAKVAA
SNGSVAPNVQTTNPLKSKSFNGREAQVTKQGKHDSAPAESADGEKVKPKSQKKQAHETSE
DDTQSSNSPKADDGKPRKVGALPNYGFSFKCDQRAEKRKEFYVKLEEKTHAKEEEINSMQ
AKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKTASG
ADSEETQTPRLGRLSLDERASKDNPTAKGIMPTVDLKKQPVRKSLPRLPSQKTVLPDGKP
APAKAAIIPAKVRPEKKKLEKDAETVNQTSHPTEEEAQVTVSSNADVEDSHETVSPRMNE
DRADKSIEVSEAVAVEH

Other information
Ka divergence:-0.0335202KaKs divergence:-0.477681
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1212Length 2 (bp):1314Length divergence:0.04
MFE 1 (kcal):-326.25MFE 2 (kcal):-352.57MFE divergence0.039