Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25520-AT4G32390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Drug/metabolite transporter superfamily protein
Function (paralog2):Nucleotide-sugar transporter family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.47224576445066
Log2 mRNA fold difference:-0.49818114997697
Log2 TE fold difference:0.025091349818845
Sequences
Protein sequence

MGKGRALSDGVIKKIILSYTYVAIWIFLSFTVIVYNKYILDKKMYNWPFPITLTMIHMGF
CSSLAVILIKVFKVVEPVSMSRETYLRSVVPIGALYSLSLWLSNSAYIYLSVSFIQMLKA
LMPVAVYSIGVLLKKETFKSQTMTNMLSISFGVAIAAYGEAKFDGWGVFLQLGAVAFEAT
RLVLIQILLTSKGINLNPITSLYYVAPCCLVFLSVPWIFVEFPVLRDTSSFHFDFVIFGT
NSVCAFALNLAVFLLVGKTSALTMNVAGVVKDWLLIAFSWSVIKDTVTPINLFGYGLAFL
GVGYYNHCKLQALKAKDAQKKVQASDDEAGKLLEERESEAKRNETQD

MGKGGALSDGVIKKILLSYTYVAIWIFLSFTVIVYNKYILDKKMYNWPFPITLTMIHMAF
CSSLAVILIKVFKIVEPVSMSRDTYIRSVVPIGALYSLSLWLSNSAYIYLSVSFIQMLKA
LMPVAVYSIGVLLKKESFKSETMTNMLSISFGVAIAAYGEAKFDTWGVMLQLGAVAFEAT
RLVLIQILLTSKGINLNPITSLYYVAPCCLVFLFFPWIFVELPILRETSSFHFDFVIFGT
NSVCAFALNLAVFLLVGKTSALTMNVAGVVKDWLLIAFSWSVIKDTVTPLNLFGYGLAFL
GVAYYNHCKLQALKAKDAQKKVQQGDEEEAGKLLEERESEAAAKRNETED

Other information
Ka divergence:-0.294402KaKs divergence:0.999821
GC content 1 (%):42GC content 2 (%):45GC content divergence:0.034
Length 1 (bp):1044Length 2 (bp):1053Length divergence:0.004
MFE 1 (kcal):-291.79MFE 2 (kcal):-307.8MFE divergence0.027