Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25580-AT4G32450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Pentatricopeptide repeat (PPR) superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.9901242974057
Log2 mRNA fold difference:-0.6157013107484
Log2 TE fold difference:-1.3250915365858
Sequences
Protein sequence

MYTKLSLFPRKSSSLLSIANEKRIHQFLRNLCTAVERLDFGNSNDSSEMNPREGYNGRIQ
NRTGSSGEVSESIHTQSQSLGSNQGRNEQSWKQSPSLSNSQVQSQYQGNWYGTNSDYQNG
VGSSWHSGKTIDREVYDMIMEFDEYCIQENVRVALTTMEKLEKKGYVMDFVRLLKLTQLC
REGNVYYEVSVLEEAKVSVLAKIRALVNNLEANYLKYYTDIMIEEYDAFCKHGKVKKALY
TIDILASMNYVVDLSRLLRLAKICGEAEGLQEAKTVHGKISASVSHLDLSSNHVLLEMYS
NCGLANEAASVFEKMSEKNLETWCIIIRCFAKNGFGEDAIDMFSRFKEEGNIPDGQLFRG
IFYACGMLGDVDEGLLHFESMSRDYGIAPSIEDYVSLVEMYALPGFLDEALEFVERMPME
PNVDVWETLMNLSRVHGNLELGDYCAEVVEFLDPTRLNKQSREGFIPVKASDVEKESLKK
RSGILHGVKSSMQEFRAGDTNLPENDELFQLLRNLKMHMVEVGYVAETRMALHDIDQESK
ETLLLGHSERIAFARAVLNSAPRKPFTVIKNLRVCVDCHNALKIMSDIVGREVITRDIKR
FHQMKNGACTCKDYW

MIYTLTRGSLLGSTCKLRYSSLFSYLSTAALRLGFENPTNGNPMDNSSHHIGYVNGFNGG
EQSLGGFQQNSYEQSLNPVSGQNPTNRFYQNGYNRNQSYGEHSEIINQRNQNWQSSDGCS
SYGTTGNGVPQENNTGGNHFQQDHSGHSSLDELDSICREGKVKKAVEIIKSWRNEGYVVD
LPRLFWIAQLCGDAQALQEAKVVHEFITSSVGISDISAYNSIIEMYSGCGSVEDALTVFN
SMPERNLETWCGVIRCFAKNGQGEDAIDTFSRFKQEGNKPDGEMFKEIFFACGVLGDMNE
GLLHFESMYKEYGIIPCMEHYVSLVKMLAEPGYLDEALRFVESMEPNVDLWETLMNLSRV
HGDLILGDRCQDMVEQLDASRLNKESKAGLVPVKSSDLVKEKLQRMAKGPNYGIRYMAAG
DISRPENRELYMALKSLKEHMIEIGYVPLSKLALHDVDQESKDENLFNHNERFAFISTFL
DTPARSLIRVMKNLRVCADCHNALKLMSKIVGRELISRDAKRFHHMKDGVCSCREYW

www.000webhost.com

Other information
Ka divergence:-0.0152768KaKs divergence:0.216771
GC content 1 (%):39GC content 2 (%):40GC content divergence:0.013
Length 1 (bp):1848Length 2 (bp):1614Length divergence:-0.068
MFE 1 (kcal):-508.66MFE 2 (kcal):-465.61MFE divergence-0.044