Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25590-AT4G32440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant Tudor-like protein
Function (paralog2):Plant Tudor-like RNA-binding protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.87162513287769
Log2 mRNA fold difference:0.84595734741832
Log2 TE fold difference:0.034985337868811
Sequences
Protein sequence

MRFRRGSRVEVFSIKEASYGVWRSAEIISGNGHTYNVRYYSFEIANNEVVEDRVPRKIIR
PCPPQVDVDRWEAGELVEVLDNNISWKTATVLEVLSGRYYVVRLLGAKAELTVHKVYLRA
RQSWQDERWVMIGKETSVASLRVLKRPSPCDWAESAESCTRSPKKIRSLEEEGHQHRFAS
SSAQKVYNDSSERRGVELYVKASCNENKSGFRQMVRMVPTLVVVMLNLQKKHLDAEMKLG
ENIHYQPKDNHLQSAGWISLPTIANVTSRLWNCPCLFVGGICTVGLVIKIYRKVLNFYEI
KAMTFQAELPSLKKLKRLREEEEALRIAMFLCHHYRFYIRLYSTLRKIIELNISDSLELM
LIQNFMVVTKLMNNIMICINL

MRIRKGSRVEVFSNKEAPYGAWRCAEIVSGNGHTYNVRFYSFQIEHEEAVMEKVPRKIIR
PCPPLVDVERWDTGELVEVLDNFSWKAATVREELSGHYYVVRLLGTPEELTFHKVNLRAR
KSWQDERWVAIGKISGSLKSSTLTGSDVHQKLQPHRNSMPLHEPSVVSARLLKRPSPYNW
SECAESCTGNPKKMRSLEKEGQQQKVDAISCRPENRGGKSHVQASLNNHKTGYCQIVRVR
SKGFSESVRADDCSDSDVCSVGSCSATSYDESNMPPCMLDGSTQQADSCSSDAESSCGLG
EEPRWKHSSVGDGARNSCRSELYSYRSTLGELFSSGPLSWEQEASLTDLRLSLNISDDEH
LMEEQCCLIRACRPFASRGLTLMLGFTPSPLTI

Other information
Ka divergence:-0.467621KaKs divergence:0.0758946
GC content 1 (%):39GC content 2 (%):44GC content divergence:0.06
Length 1 (bp):1146Length 2 (bp):1182Length divergence:0.015
MFE 1 (kcal):-306.8MFE 2 (kcal):-365MFE divergence0.087