Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25610-AT4G32530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATPase, F0/V0 complex, subunit C protein
Function (paralog2):ATPase, F0/V0 complex, subunit C protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.47839393622865
Log2 mRNA fold difference:-1.0994912387925
Log2 TE fold difference:0.60108173573746
Sequences
Protein sequence

MSGVAIHASSWGAALVRISPYTFSAIGIAISIGVSVLGAAWGIYITGSSLIGAAIEAPRI
TSKNLISVIFCEAVAIYGVIVAIILQTKLESVPSSKMYDAESLRAGYAIFASGIIVGFAN
LVCGLCVGIIGSSCALSDAQNSTLFVKILVIEIFGSALGLFGVIVGIIMSAQATWPTK

MSGVVALGHASSWGAALVRISPYTFSAIGIAISIGVSVLGAAWGIYITGSSLIGAAIEAP
RITSKNLISVIFCEAVAIYGVIVAIILQTKLESVPSSKMYDAESLRAGYAIFASGIIVGF
ANLVCGSVSTLFSFLTVLVFGFHCQICNRGPHFSCRLCVGIIGSSCALSDAQNSTLFVKI
LVIEIFGSALGLFGVIVGIIMSAQATWPTK

www.000webhost.com

Other information
Ka divergence:1KaKs divergence:0.993808
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):537Length 2 (bp):633Length divergence:0.082
MFE 1 (kcal):-166.96MFE 2 (kcal):-183.26MFE divergence0.047