Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25670-AT4G32610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):copper ion binding

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.5110163916335
Log2 mRNA fold difference:-1.1948387045027
Log2 TE fold difference:-0.42523075523918
Sequences
Protein sequence

MAGGGNRRDEGSITIQSTNLFAALDTRKKKKKSDKAGKSKGSSKSREPEKEPEPQVYWAP
TPLKVKSWADIDDEDDDDDYYATTAPPQSGWSTSLPSHTDSKDVHVEESESEEDILDEGD
DDVEEEQEQETEVQVHPEPEVKKAPEVPAPPKEAERQLSKKERKKKELAELEALLADFGV
APKENNGLEESQEAGQEKKEDVNGEGEKKENAAGGESKASKKKKKKDKQKEVKESQEQQA
NNNADAVDEAAGSEPTEEESPIDVKERIKKLASMKKKKSGKEVDAAAKAAAEEAAARRKK
LAAAKKKEKNHYNQQPVR

MVGGGNRRDEGSMPIQNTNLFAALDTSRKKKKSDKAGKSKASSKREDSQKEPEPQVFWAP
TPLKAKAWADIDSDDEDDDYYATTAPPQSLWSTSEASHSDAKDVPAEEIESEEDTLDDGD
DDDVEEDHEQGTETQVHPEAEPEVKKAPEVRAPPKEAERQLSKKERKKKELAELEALLAD
FGVATKDENGQQDSQDKGEKKEVNDEGEKKENTTGESKASKKKKKKDKQKELKESQSEVK
SNSDAASESAEQEESSSSIDVKERLKKIASMKKKKSSKEVDGASTAAAKEAAARKAKLAA
AKKKEKKNYNQQPVR

Other information
Ka divergence:0.0899596KaKs divergence:0.697479
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):957Length 2 (bp):948Length divergence:-0.005
MFE 1 (kcal):-290.93MFE 2 (kcal):-281.31MFE divergence-0.017