Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25770-AT4G32870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Polyketide cyclase/dehydrase and lipid transport superfamily protein
Function (paralog2):Polyketide cyclase/dehydrase and lipid transport superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.7580513674221
Log2 mRNA fold difference:3.3453367496929
Log2 TE fold difference:-0.42431675856016
Sequences
Protein sequence

MEKASSPEKWLAKVSVTLTKAKPDEIWPLFTDFFNLHKWLPTLATCHGVHGNNGEQGCIR
FCSGFSIGSNGVDSAARWSKEKLVAVNPVERVMRYEIVESNTGFESYVSTVKILPRGEDG
CVIEWSFTVDPVRGLSLENLVKKYEKALEIITKNMEEDALRRRESSS

MGTETVSFKWEGKKVAQVNGVTAEKVWSVFSDFCNVQEWFPSVDTCYRVQGTDGVPGLIR
YCSTTKTKEEGSRWAKEKLVKIDPIGRCLSYEILENNVGFRSYVATVQVTPVDGEDQVSR
IEWSFVADPVDGWKKEDLESYVDFCLQHMANKMELNL

Other information
Ka divergence:-0.264095KaKs divergence:0.105394
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):504Length 2 (bp):474Length divergence:-0.031
MFE 1 (kcal):-165.4MFE 2 (kcal):-145.04MFE divergence-0.066