Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25850-AT4G32850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):poly(A) polymerase 2
Function (paralog2):nuclear poly(a) polymerase

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.4776214442695
Log2 mRNA fold difference:2.3828280341535
Log2 TE fold difference:0.1060503229678
Sequences
Protein sequence

MVSTQQRTDDDSSQPVKASLKSYGITEPLSIAGPSAADVKRNLELEKFLVDEGLYESKEE
TMRREEVVVRIDQIVKHWVKQLTRQRGYTDQMVEDANAVIFTFGSYRLGVHGPMADIDTL
CVGPSYVNREEDFFIFFRDILAEMEEVTELQPVTDAHVPVMKFKFQGISIDLLYASISLL
VIPQDLDISNSSVLCDVDEQTVRSLNGCRVADQILKLVPNSEHFRTTLRCLKYWAKKRGV
YSNVTGFLGGVNWALLVARLCQFYPNAIPSMLVSRFFRVYTQWRWPNPVMLCAIEEDDLS
FPVWDPRKNHRDRYHLMPIITPAYPCMNSSYNVSQSTLRVMTEQFQFGNTICQEIELNKQ
HWSSLFQQYMFFEAYKNYLQVDVLAADAEDLLAWKGWVESRFRQLTLKIERDTNGMLMCH
PQPNEYVDTSKQFRHCAFFMGLQRADGFGGQECQQFDIRGTVDEFRQEVNMYMFWRPGMD
VHVSHVRRRQLPSFVFPNGYKRSRQSRHQSQQCREPGDEGVGSLSDSVERYAKRKNDDEI
MNSRPEKREKRASCSLHTLDAASPDSSGITTSGTPQIGIVPGPRAECLVTGDLVCNVTSL
PNVEVEAEKFISKITELRKFSQYEHTSGSEQILEVDSRALVQSYHDLAEPVAKHVRPDLS
ALLACEGGQNKEIGHDMGSESINDTDTQHLPRRLNVNEDVDEVEREAKLGEIAGGVLWNG
HCGRNLDHEGFVTPANLDSAVENRNLHSDGLFKSGLPEELQSNSLLSGTGKLDDGARSES
LQNEMMRHVFLQPIIGLCKS

MMVGTQNLGGSLPPLNSPKSYGITKPLSLAGPSSADIKRNVELEKYLVDEGLYESKDDTM
RREEVLGRIDQIVKHWVKQLTQQRGYTDQMVEDANAVIFTFGSYRLGVHGPGADIDTLCV
GPSYVNREEDFFIILHDILAEMEEVTELHPVPDAHVPVMKFKFQGIPIDLLYASISLLVV
PQDLDISSSSVLCEVDEPTVRSLNGCRVADQILKLVPNFEHFRTTLRCLKYWAKKRGVYS
NVTGFLGGVNWALLVARVCQLYPNAIPSMLVSRFFRVYTQWRWPNPVMLCAIEEDELGFP
VWDRRKNHRDRYHLMPIITPAYPCMNSSYNVSQSTLRVMTEQFQFGNNILQEIELNKQHW
SSLFEQYMFFEAYKNYLQVDIVAADAEDLLAWKGWVESRFRQLTLKIERDTNGMLMCHPQ
PNEYVDTARQFLHCAFFMGLQRAEGVGGQECQQFDIRGTVDEFRQEVNMYMFWKPGMDVF
VSHVRRRQLPPFVFPNGYRRPRQSRHQNLPGGKSGEDGSVSHSGSVVERHAKRKNDSEMM
DVRPEKPEKRASLSPQSLDIVSPENSAITTGWTPPVCNLRRPPSEEIEADNLNTECTELT
DLARNECNSGSEQVLEVDSMAVVQECSDPAEPLGKCVTPDSVDVVACVSGQEENLDRNLR
SVSISGTDSPLLPSRSCGQNRDYEGFGFPAANSDPMGKKNLYSQSGMSEDLQSNSLVSGM
EKSEDRARSESFQKSQIRHAIDVKKTGDFNSNCCVGQTTESRSFW

Other information
Ka divergence:-0.140126KaKs divergence:-0.0346934
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):2403Length 2 (bp):2298Length divergence:-0.022
MFE 1 (kcal):-738.87MFE 2 (kcal):-737.86MFE divergence-0.001