Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25880-AT4G32830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ataurora2
Function (paralog2):ataurora1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.23221534618683
Log2 mRNA fold difference:0.75784618463911
Log2 TE fold difference:-0.55542876630091
Sequences
Protein sequence

MGISTETQQIAASEAAQKRWTTSDFDIGKPLGRGKFGHVYLAREKRSDHIVALKVLFKAQ
LQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAVRGELYKELQKCKYF
SERRAATYVASLARALIYCHGKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTM
CGTLDYLPPEMVESVEHDASVDIWSLGILCYEFLYGVPPFEAREHSETYKRIVQVDLKFP
PKPIVSSSAKDLISQMLVKESTQRLALHKLLEHPWIVQNADPSGLYRG

MAIPTETQHQEKEASDASAAAAQKRWTLSDFDIGKPLGRGKFGHVYLAREKRSNHVVALK
VLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAARGELYKDL
QKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLIGAQGELKIADFGWSVHTF
NRRRTMCGTLDYLPPEMVESVEHDASVDIWSLGILCYEFLYGVPPFEAMEHSDTYRRIVQ
VDLKFPPKPIISASAKDLISQMLVKESSQRLPLHKLLEHPWIVQNADPSGIYRV

www.000webhost.com

Other information
Ka divergence:-0.230028KaKs divergence:0.00263852
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):867Length 2 (bp):885Length divergence:0.01
MFE 1 (kcal):-275.9MFE 2 (kcal):-277.05MFE divergence0.002