Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G25940-AT4G32940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha-vacuolar processing enzyme
Function (paralog2):gamma vacuolar processing enzyme

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.8168415713918
Log2 mRNA fold difference:4.8119879465134
Log2 TE fold difference:0.069449455058267
Sequences
Protein sequence

MTTVVSFLALFLFLVAAVSGDVIKLPSLASKFFRPTENDDDSTKWAVLVAGSSGYWNYRH
QADVCHAYQLLKKGGVKEENIVVFMYDDIAKNEENPRPGVIINSPNGEDVYNGVPKDYTG
DEVNVDNLLAVILGNKTALKGGSGKVVDSGPNDHIFIYYSDHGGPGVLGMPTSPNLYAND
LNDVLKKKYASGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGE
DPSPPSEYETCLGDLYSVAWIEDSEKHNLQTETLHEQYELVKKRTAGSGKSYGSHVMEFG
DIGLSKEKLVLFMGTNPADENFTFVNENSIRPPSRVTNQRDADLVHFWHKYQKAPEGSAR
KVEAQKQVLEAMSHRLHVDNSILLIGILLFGLEGHAVLNKVRPSGEPLVDDWDCLKSLVR
AFERHCGSLSQYGIKHMRSIANMCNAGIQMRQMEEAAMQACPTIPTSPWSSLDRGFSA

MATTMTRVSVGVVLFVLLVSLVAVSAARSGPDDVIKLPSQASRFFRPAENDDDSNSGTRW
AVLVAGSSGYWNYRHQADICHAYQLLRKGGLKEENIVVFMYDDIANNYENPRPGTIINSP
HGKDVYQGVPKDYTGDDVNVDNLFAVILGDKTAVKGGSGKVVDSGPNDHIFIFYSDHGGP
GVLGMPTSPYLYANDLNDVLKKKHALGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTA
SNAEESSWGTYCPGEEPSPPPEYETCLGDLYSVAWMEDSGMHNLQTETLHQQYELVKRRT
APVGYSYGSHVMQYGDVGISKDNLDLYMGTNPANDNFTFADANSLKPPSRVTNQRDADLV
HFWEKYRKAPEGSARKTEAQKQVLEAMSHRLHIDNSVILVGKILFGISRGPEVLNKVRSA
GQPLVDDWNCLKNQVRAFERHCGSLSQYGIKHMRSFANICNAGIQMEQMEEAASQACTTL
PTGPWSSLNRGFSA

Other information
Ka divergence:-0.0931115KaKs divergence:-0.488157
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1437Length 2 (bp):1485Length divergence:0.016
MFE 1 (kcal):-449.61MFE 2 (kcal):-462.67MFE divergence0.014