Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G26190-AT4G33050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):calmodulin-binding family protein
Function (paralog2):calmodulin-binding family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.42320533456184
Log2 mRNA fold difference:0.65310202787807
Log2 TE fold difference:-0.21773212442472
Sequences
Protein sequence

MGLSLSLLLSAWKEVVTTQFFSFKNPVESFLETRSFSLKLKEGGLTSRTNSFKSENPQEK
SPKTGMERSLSFNSWEIVTEVETEPMNKEDEEIVEPTKPARNSLNGRNCERIQITKPTIT
PPTPFVFFSPRPVTELDAAATTLQKVYKSYRTRRNLADCAVVVEELWWKTLDAAALNLSS
VAFFEEEKHETAVSKWARARTRAAKVGKGLSKDEKAQKLALQHWLEAIDPRHRYGHNLHF
YYDVWSASMSAQPFFYWLDIGDGKDVNLEHHPRSVLQKQCIKYLGPLEREAYEVIVEDGK
LMNKQSMTLINSTEDSKSIFVLSTTRTLYVGQKKKGRFQHSSFLSGGATTAAGRLVAREG
ILEAIWPYSGHYLPTEDNFNEFISFLEENNVDMTNVKRCSVNEEYSSFNSSGYEEEATKE
EEAEKKPAETIVTEEQEEEKERERPVFQLAKRLSCKWNSGVGPRIGCVRDYPMELQSQAF
EQVSLSPRISPGSTRFPSPYGPIPSPRPSPRVRVSPRLAYMGIPSPRVQVNC

MGLEVGSLCFKLKDGGLTSRTNSFKRDDTNRHQNSPKSTMERSLSFNSWEVPKETKTDSD
FEVLETKKSTPNTLNGRNCERIQIKKPTVTPPEPFVFFSPRPVTELDAAATTLQKVYKSY
RTRRNLADCAVVVEELWWRTLEGAALDLSSVSFFGEEKHETAVSKWARARKRAAKVGKGL
SKDEKAQKLALQHWLEAVSPHNLNIFVTSYQRQVPYLTSKAIIEYTLMIHLLKLQIDPRH
RYGHNLHFYYDVWSASKSTQPFFYWLDIGDGKDVNLEKHPRSVLQKQCIRYLGPMEREAY
EVIVEDGRLMYKQGMTLINSTEEAKSIFVLSTTRNLYVGIKKKGLFQHSSFLSGGATTAA
GRLVARDGILEAIWPYSGHYLPTEDNFKEFISFLEEHNVDLTNVKRCSVNEEYSSFKSTA
DEEEERKEVSEEVEIPSEKEERARPVFDPVKRLSCKWTSGYGPRIGCVRDYPMELQAQAL
EQVSLSPRVSPANSYGPIPSPRPSPKVRVSPRLAYMGIPSPRAVKC

www.000webhost.com

Other information
Ka divergence:-0.206201KaKs divergence:-0.05131
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1599Length 2 (bp):1581Length divergence:-0.006
MFE 1 (kcal):-474.71MFE 2 (kcal):-469.93MFE divergence-0.005