Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G26570-AT4G33390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF827)
Function (paralog2):Plant protein of unknown function (DUF827)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-4.0988878723126
Log2 mRNA fold difference:-5.7984554398847
Log2 TE fold difference:2.4555414495858
Sequences
Protein sequence

MEDLKTVEASDNVVSDNVEKVNPELIDSTIRESNIQSATKVDNIPQSQTDTEETQQSQTD
TEETQQSQTDDTTGNAKIYVDDTFSPSDAATAAVLTGKDSTSTTIVEEVMEPDEIGLPSV
KITEAATGTARNGGGSPRTVSSPRFSGSPVSTGTPKNVDSHRGLIDTAAPFESVKEAVSK
FGGITDWKSHRMQAVERRKLIEEELKKIHEEIPEYKTHSETAEAAKLQVLKELESTKRLI
EQLKLNLDKAQTEEQQAKQDSELAKLRVEEMEQGIAEDVSVAAKAQLEVAKARHTTAITE
LSSVKEELETLHKEYDALVQDKDVAVKKVEEAMLASKEVEKTVEELTIELIATKESLESA
HASHLEAEEQRIGAAMARDQDTHRWEKELKQAEEELQRLNQQIHSSKDLKSKLDTASALL
LDLKAELVAYMESKLKQEACDSTTNTDPSTENMSHPDLHAAVASAKKELEEVNVNIEKAA
AEVSCLKLASSSLQLELEKEKSTLASIKQREGMASIAVASIEAEIDRTRSEIASVQSKEK
DAREKMVELPKQLQQAAEEADEAKSLAEVAREELRKAKEEAEQAKAGASTMESRLFAAQK
EIEAAKASERLALAAIKALEESESTLKANDTDSPRSVTLSLEEYYELSKRAHEAEELANA
RVAAAVSRIEEAKETEMRSLEKLEEVNRDMDARKKALKEATEKAEKAKEGKLGVEQELRK
WRAEHEQKRKAGDGVNTEKNLKESFEGGKMEQSPEAVVYASSPSESYGTEENSETNLSPQ
TKSRKKKKKLSFPRFFMFLSKKKSHNN

MEDLKTTDALSLPVVSDNGGIIEPELQLPQAIPTELENNEEENGTIQQSQSEEDSAENGK
IYMDDTFLPSKSQVKETQDSPTTPSFVSPSAEIVLPRVNTKYEAEGTTRNAVSPRPLYSP
RSIGSPRALLSPRFAGSSSPLSNGTPISMDSFRDSIDTASPFESVKEAVSKFGGITDWKA
HRMKVLERRNFVEQELDKIQEEIPEYKKKSEMVEMSKMLAVEELESTKRLIEELKLNLEK
AETEEQQAKQDSELAKLRVQEMEQGIADEASVASKAQLEVAQARHTSAISELESVKEELQ
TLQNEYDALVKEKDLAVKEAEEAVIASKEVERKVEELTIELIATKESLECAHSSHLEAEE
HRIGAAMLRDQETHRWEKELKQAEEELQRLKQHLVSTKELQVKLEFASALLLDLKKELAD
HKESSKVKEETSETVVTNIEISLQEKTTDIQKAVASAKKELEEVNANVEKATSEVNCLKV
ASSSLRLEIDKEKSALDSLKQREGMASVTVASLEAEIDITRCEIALVKSKEKETREEMVE
LPKQLQQASQEADEAKSFAELAREELRKSQEEAEQAKAGASTMESRLFAAQKEIEAIKAS
ERLALAAIKALQESESSSKENAVDSPRTVTLTIEEYYELSKRAHEAEEAANARVAAAVSE
VGEAKETEKRSLEKLEEVNKEMVERKATLAGAMEKAEKAKEGKLGVEQELRKWREVSEKK
RKNGSSHGKSIQGSKEKEAETSVSNETETNPIPQVNPVKKKKKLFPRFFMFLMKKKSHK

www.000webhost.com

Other information
Ka divergence:0.230442KaKs divergence:0.207442
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):2424Length 2 (bp):2340Length divergence:-0.018
MFE 1 (kcal):-710.56MFE 2 (kcal):-636.92MFE divergence-0.055