Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G26740-AT2G26750
Species:Arabidopsis
Duplication type:TD
Function (paralog1):soluble epoxide hydrolase
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.9254513159205
Log2 mRNA fold difference:-2.054469470788
Log2 TE fold difference:0.078471365907821
Sequences
Protein sequence

MEHRKVRGNGIDIHVAIQGPSDGPIVLLLHGFPELWYSWRHQIPGLAARGYRAVAPDLRG
YGDSDAPAEISSYTCFNIVGDLIAVISALTASEDEKVFVVGHDWGALIAWYLCLFRPDRV
KALVNLSVPFSFRPTDPSVKPVDRMRAFYGDDYYICRFQEFGDVEAEIAEVGTERVMKRL
LTYRTPGPVIIPKDKSFWGSKGETIPLPSWLTEEDVAYFVSKFEEKGFSGPVNYYRNFNR
NNELLGPWVGSKIQVPTKFVIGELDLVYYMPGVKEYIHGPQFKEDVPLLEEPVVMEGVAH
FINQEKPQEILQIILDFISKF

MEHRNVRGNGIDIHVAIQGPSDGTIVLLLHGFPELWYSWRHQISGLAARGYRAVAPDLRG
YGDSDAPAEISSFTCFNIVGDLVAVISTLIKEDKKVFVVGHDWGALIAWYLCLFRPDKVK
ALVNLSVPLSFWPTDPSVKPVDRMRAVYGNDYYVCRFQEVGDIEAEIAEVGTERVMKRLL
TYRTPGPLIIPKDKSFWGSKGETIPLPSWLTEEDVAYFVSKFKEKGFCGPVNYYRNFNRN
NELLGPWVGSKIQVPTKFVIGELDLVYYMPGVKEYIHGPQFKEDVPLIEEPVVMEGVAHF
LNQEKPQEILQIILDFISTF

Other information
Ka divergence:0.713645KaKs divergence:0.758392
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):966Length 2 (bp):963Length divergence:-0.002
MFE 1 (kcal):-307.56MFE 2 (kcal):-296.9MFE divergence-0.018