Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G27710-AT2G27720
Species:Arabidopsis
Duplication type:TD
Function (paralog1):60S acidic ribosomal protein family
Function (paralog2):60S acidic ribosomal protein family

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.25990564216963
Log2 mRNA fold difference:1.57001638429
Log2 TE fold difference:-1.6254620125603
Sequences
Protein sequence

MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDLAELIAAGRE
KLASVPSGGGGGVAVASATSGGGGGGGASAAESKKEEKKEEKEESDDDMGFSLFE

MKVVAAFLLAVLSGKASPTTGDIKDILGSGIMVLVLDCVVIGDCFGAETEDSQIELLLKE
VKGKDLAELIAAGREKLASVPSGGGGGVAVASATSGGGGGGGAPAAESKKEEKKEEKEES
DDDMGFSLFE

Other information
Ka divergence:0.464936KaKs divergence:0.999918
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):348Length 2 (bp):393Length divergence:0.061
MFE 1 (kcal):-107MFE 2 (kcal):-112.1MFE divergence0.023