Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G27960-AT2G27970
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cyclin-dependent kinase-subunit 1
Function (paralog2):CDK-subunit 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.84428368323889
Log2 mRNA fold difference:-2.1619688777368
Log2 TE fold difference:1.3745751852719
Sequences
Protein sequence

MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAVHRP
EPHIMLFRRPLNYQQQQENQAQNMLVK

MGQIQYSDKYFDDTFEYRHVVLPPEVAKLLPKNRILSESEWRAIGVQQSRGWVHYAIHRP
EPHIMLFRRPLNYQQEHQAQIAK

Other information
Ka divergence:0.435819KaKs divergence:-0.334722
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):264Length 2 (bp):252Length divergence:-0.023
MFE 1 (kcal):-73.6MFE 2 (kcal):-79.9MFE divergence0.041