Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G28755-AT2G28760
Species:Arabidopsis
Duplication type:TD
Function (paralog1):UDP-D-glucuronate carboxy-lyase-related
Function (paralog2):UDP-XYL synthase 6

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.97559525739479
Log2 mRNA fold difference:-0.40001428110963
Log2 TE fold difference:1.2689783781705
Sequences
Protein sequence

MEGLKRLMAGDKSGPINIGNPGEFSIVELAETVKALIKPDVEIKIVENIPDDPRQS

MASNSSNGTTTTKPPPMPSPLRNSKFFQSNMRILVTGGAGFIGSHLVDKLMQNEKNEVIV
ADNYFTGSKDNLKKWIGHPRFELIRHDVTEPLFVEVDQIYHLACPASPIFYKYNPVKTIK
TNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQTESYWGNVNPIGVRSCYDEGKRV
AETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRGEALTVQKPGTQTR
SFCYVSDMVEGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELIKPDVEIKMVENTPDD
PRQRKPDISKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVPKK

Other information
Ka divergence:-1KaKs divergence:-0.982265
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):171Length 2 (bp):1032Length divergence:0.716
MFE 1 (kcal):-38.6MFE 2 (kcal):-306.34MFE divergence0.776