Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G28850-AT2G28860
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cytochrome P450, family 710, subfamily A, polypeptide 3
Function (paralog2):cytochrome P450, family 710, subfamily A, polypeptide 4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.1245008180471
Log2 mRNA fold difference:2.8515466080107
Log2 TE fold difference:-0.67874477823351
Sequences
Protein sequence

MVSSVSLFASLTPYLVSALLLFLLLEQLFYRLKKRNLPGPLFVFPIIGNVVALIRDPTSF
WDKQSAMADTSVGLSVNYLIGKFIIYIKDAELSNKVFSNIRPDAFQLVGHPFGKKLFGDH
SLIFMFGENHKSVRRQVAPNFTRKPLSAYSSLQQIVILRHLRQWEESFSSGSRPVSMRQL
IRELNLETSQTVFVGPYLDKEVKNTIRDDYNVFNPGTMALPIDLPGFTFGEARRAVSRLV
NTMSLCVRKSKEKMAAGENPTCLVDFWTHSIVAESPPPPHSKDEEISCVLVDFLFASQDA
STSSLLWAVVLLESEPEVLRRVREDVARFWSPESKESITADQLAEMKYIRAVAREVLRYR
PPASMVPHVAVSDFRLTESYTIPKGTIVFPSLFDASFQGFTEPDRFDPDRFSETRQEDEV
FKRNFLTFGIGSHQCVGQRYALNHLVLFIAMFSSMFDFKRVRSDGCDEIVHIPTMSPKDG
CTVFLSSRLVTSP

MVSSVSLFASLTPYLVSALLLFLLLEQLFYRVKKRNLPGPLFVFPIIGNVVALIRDPTSF
WDKQSAMADTSVGLSVNYLIGKFIIYIKDAELSNKVLSNIRPDAFQLTGHPFGKKLFGDH
SLIFMFGEDHKSVRRQVAPNFTRKPLSAYSSLQQIVILRHLRQWEESFSSGSRPVSMRQL
IRELNLETSQTVFVGPYLDKEVKKTICDDYSLLTLGTMAIPIDLPGFTFGEARQAVSRLV
NTMSVCVGKSKAKMAAGENPTCLVDFWTHSIIEENPPPPHSKDKEISCVLVDFMFASQDA
STSSLLWAVVMLESEPEVLRRVREDVARFWSSESNELITADQLAEMKYTRAVAREVLRYR
PPASMIPHVAVSDFRLTESYTIPKGTIVFPSLFDASFQGFTEPDRFDPDRFSETRQEDEV
FKRNFLTFGNGSHQCVGQRYAMNHLVLFIAMFSSMFDFKRVRSDGCDDIVHIPTMSPKDG
CTVFLSSRLVTSP

Other information
Ka divergence:0.260989KaKs divergence:0.999762
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1482Length 2 (bp):1482Length divergence:0
MFE 1 (kcal):-466.39MFE 2 (kcal):-480.69MFE divergence0.015