Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G29140-AT2G29190
Species:Arabidopsis
Duplication type:TD
Function (paralog1):pumilio 3
Function (paralog2):pumilio 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.54903405261659
Log2 mRNA fold difference:0.31036388880123
Log2 TE fold difference:0.22912766054996
Sequences
Protein sequence

MMIPELGRRPMHRGNEDSSFGDDYEKEIGVLLGEQQRRQVEADELERELNLYRSGSAPPT
VDGSLSAAGGLFSGGGGASFLEFGGVNKGNGFGGDDEEFRKDPAYLSYYYANMKLNPRLP
PPLMSREDLRVAQRLKGSNNVLGGVGDRRKVNDSRSLFSMPPGFEAGKPGASASEWDANG
LIGLGLGGKQKSFADIFQADMGHPVVQQPSRPASRNTFDENVDSNNNLSPSASQGIGAPS
PYCYAAVLGSSLSRNGTPDPQGIARVPSPCLTPIGSGRVSSNDKRNTSNQSPFNGVTSGL
NESSDLVNALSGLNLSGTGGLDERGQAEQDVEKVRNYMFGLQDGHNEVNPHGFPNRSDQA
RGTASCRNSQMRGSQGSAYNSGSGVANPYQHHDSPNYYALNPAVASMMANQLGTNNYSPM
YENASATLGYSAMDSRLHGGSFVSSGQNLSESRNIGRVGNRMMEGGTGHPSHLADPMYHQ
YARFSENADSFDLLNDPSMDRNYGNSYMNMLEIQRAYLGSQKSQYGLPYKSGSPNSHSYY
GSPTFGSNMSYPGSPLAHHGMPNSLMSPYSPMRRGEVNMRYPAATRNYTGGVMGSWHMDA
SLDEGFGSSMLEEFKSNKTRGFELSEIAGHVVEFSSDQYGSRFIQQKLETATTDEKNMVY
EEIMPKALALMTDVFGNYVIQKFFEHGLPPQRRELGEKLIDNVLPLSLQMYGCRVIQKAI
EVVDLDQKIQMVKELDGHVMRCVRDQNGNHVVQKCIECVPEENIEFIISTFFGHVVTLST
HPYGCRVIQRVLEHCHNPDTQSKVMEEILSTVSMLTQDQYGNYVVQHVLEHGKPDERTVI
IKELAGKIVQMSQQKFASNVVEKCLTFGGPEERELLVNEMLGTTDENEPLQAMMKDQFAN
YVVQKVLETCDDQQRELILTRIKVHLNALKKYTYGKHIVARVEKLVAAGERRMALQSLPQ
PLVA

MIPELGRRPMHRGNEDSSFGDDYEKEIGVLLGEQQRRQVEADELERELNLYRSGSAPPTV
DGSVSAAGGLFSGGGGAPFLEFGGGNKGNGFGGDDEEFRKDPAYLSYYYANMKLNPRLPP
PLMSREDLRVAQRLKGSSNVLGGVGDRRKVNDSQSLFSMPPGFDQRKQHEFEVEKTSASS
SEWDANGLIGLPGLGIGGKQKSFADIFQADMGHGHPVTKQPSRPASRNTFDENVDSKNNL
SPSASQGIGAPSPYSYAAVLGSSLSRNGTPDPQAIARVPSPCLTPIGSGRVSSNDKRNTS
NQSPFNGGLNESSDLVNALSGMNLSGSGGLDERGQAEQDVEKVRNYMFGLQGGHNEVNQH
GFPNKSDQAQKATGLLRNSQLRGAQGSTYNDGGGVATQYQHLDSPNYCLNNYGLNPAVAS
MMANQLGTNNYSPVYENASAASAMGFSGMDSRLHGGGYVSSGQNLSESRNLGRFSNRMMG
GGTGLQSHMADPMYHQYADSLDLLNDPSMDVNFMGNSYMNMLELQRAYLGAQKSQYGVPY
KSGSPNSHTDYGSPTFGSYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSATRNYAGGV
MGSWHMDASLDEGFGSSMLEEFKSNKTRGFELAEIAGHVVEFSSDQYGSRFIQQKLETAT
SDEKNMVYEEIMPHALALMTDVFGNYVIQKFFEHGLPPQRRELADKLFDNVLPLSLQMYG
CRVIQKAIEVVDLDQKIKMVKELDGHVMRCVRDQNGNHVVQKCIECVPEENIEFIISTFF
GNVVTLSTHPYGCRVIQRVLEHCHDPDTQSKVMDEIMSTISMLAQDQYGNYVIQHVLEHG
KPDERTVIIKELAGKIVQMSQQKFASNVVEKCLTFGGPEEREFLVNEMLGTTDENEPLQA
MMKDQFANYVVQKVLETCDDQQRELILGRIKVHLNALKKYTYGKHIVARVEKLVAAGERR
MALQSLTQPQMA

Other information
Ka divergence:-0.325752KaKs divergence:-0.216258
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2895Length 2 (bp):2919Length divergence:0.004
MFE 1 (kcal):-905.46MFE 2 (kcal):-943.01MFE divergence0.02