Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G29420-AT2G29440
Species:Arabidopsis
Duplication type:TD
Function (paralog1):glutathione S-transferase tau 7
Function (paralog2):glutathione S-transferase tau 6

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.0069237813232
Log2 mRNA fold difference:-2.0056737799568
Log2 TE fold difference:-0.99192374011854
Sequences
Protein sequence

MAERSNSEEVKLLGMWASPFSRRIEIALTLKGVSYEFLEQDITNKSSLLLQLNPVHKMIP
VLVHNGKPISESLVILEYIDETWRDNPILPQDPYERTMARFWSKFVDEQIYVTAMKVVGK
TGKERDAVVEATRDLLMFLEKELVGKDFLGGKSLGFVDIVATLVAFWLMRTEEIVGVKVV
PVEKFPEIHRWVKNLLGNDVIKKCIPPEDEHLKYIRARMEKLNIKSA

MGKNEEVKLLGIWASPFSRRIEMALKLKGVPYEYLEEDLENKSSLLLALSPIHKKIPVLV
HNGKTIIESHVILEYIDETWKHNPILPQDPFQRSKARVLAKLVDEKIVNVGFASLAKTEK
GREVLIEQTRELIMCLEKELAGKDYFGGKTVGFLDFVAGSMIPFCLERAWEGMGVEMITE
KKFPEYNKWVKKLKEVEIVVDCIPLREKHIEHMNNMAEKIRSA

www.000webhost.com

Other information
Ka divergence:0.10689KaKs divergence:0.250171
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):684Length 2 (bp):672Length divergence:-0.009
MFE 1 (kcal):-194.61MFE 2 (kcal):-193.29MFE divergence-0.003