Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G29710-AT2G29730
Species:Arabidopsis
Duplication type:TD
Function (paralog1):UDP-Glycosyltransferase superfamily protein
Function (paralog2):UDP-glucosyl transferase 71D1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.4952317980579
Log2 mRNA fold difference:2.7592346844168
Log2 TE fold difference:-0.26457039749352
Sequences
Protein sequence

MRNAELIFIPTPTVGHLVPFLEFARRLIEQDDRIRITFLLMKQQGQSHLDSYVKTISSSL
PFVRFIDVPELEEKPTLGTQSVEAYVYDFIETNVPLVQNIIMGILSSPAFDGVTVKGFVA
DFFCLPMIDVAKDASLPFYVFLTSNSGFLAMMQYLAYGHKKDTSVFARNSEEMLSIPGFV
NPVPAKVLPSALFIEDGYDADVKLAILFTKANGILVNTSFDIEPTSLNHFLGEENYPSVY
AVGPIFNPKAHPHPDQDLACCDESMKWLDAQPEASVVFLCFGSMGSLRGPLVKEIAHGLE
LCQYRFLWSLRTEEVTNDDLLPEGFMDRVSGRGMICGWSPQVEILAHKAVGGFVSHCGWN
SIVESLWFGVPIVTWPMYAEQQLNAFLMVKELKLAVELKLDYSVHSGEIVSANEIETAIS
CVMNKDNNVVRKRVMDISQMIQRATKNGGSSFAAIEKFIHDVIGTRT

MRNVELIFIPTPTVGHLVPFLEFARRLIEQDDRIRITILLMKLQGQSHLDTYVKSIASSQ
PFVRFIDVPELEEKPTLGSTQSVEAYVYDVIERNIPLVRNIVMDILTSLALDGVKVKGLV
VDFFCLPMIDVAKDISLPFYVFLTTNSGFLAMMQYLADRHSRDTSVFVRNSEEMLSIPGF
VNPVPANVLPSALFVEDGYDAYVKLAILFTKANGILVNSSFDIEPYSVNHFLQEQNYPSV
YAVGPIFDLKAQPHPEQDLTRRDELMKWLDDQPEASVVFLCFGSMARLRGSLVKEIAHGL
ELCQYRFLWSLRKEEVTKDDLPEGFLDRVDGRGMICGWSPQVEILAHKAVGGFVSHCGWN
SIVESLWFGVPIVTWPMYAEQQLNAFLMVKELKLAVELKLDYRVHSDEIVNANEIETAIR
YVMDTDNNVVRKRVMDISQMIQRATKNGGSSFAAIEKFIYDVIGIKP

Other information
Ka divergence:-0.61533KaKs divergence:-0.977632
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1404Length 2 (bp):1404Length divergence:0
MFE 1 (kcal):-409.13MFE 2 (kcal):-420.92MFE divergence0.014