Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G30140-AT2G30150
Species:Arabidopsis
Duplication type:TD
Function (paralog1):UDP-Glycosyltransferase superfamily protein
Function (paralog2):UDP-Glycosyltransferase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.68970903546203
Log2 mRNA fold difference:-0.86676605717893
Log2 TE fold difference:0.21193915623937
Sequences
Protein sequence

MDPNESPPNQFRHVVAMPYPGRGHINPMMNLCKRLVRRYPNLHVTFVVTEEWLGFIGPDP
KPDRIHFSTLPNLIPSELVRAKDFIGFIDAVYTRLEEPFEKLLDSLNSPPPSVIFADTYV
IWAVRVGRKRNIPVVSLWTMSATILSFFLHSDLLISHGHALFEPSEEEVVDYVPGLSPTK
LRDLPPIFDGYSDRVFKTAKLCFDELPGARSLLFTTAYELEHKAIDAFTSKLDIPVYAIG
PLIPFEELSVQNDNKEPNYIQWLEEQPEGSVLYISQGSFLSVSEAQMEEIVKGLRESGVR
FLWVARGGELKLKEALEGSLGVVVSWCDQLRVLCHKAVGGFWTHCGFNSTLEGIYSGVPM
LAFPLFWDQILNAKMIVEDWRVGMRIERTKKNELLIGREEIKEVVKRFMDRESEEGKEMR
RRACDLSEISRGAVAKSGSSNVNIDEFVRHITNTN

MPWPGRGHINPMLNLCKSLVRRDPNLTVTFVVTEEWLGFIGSDPKPNRIHFATLPNIIPS
ELVRANDFIAFIDAVLTRLEEPFEQLLDRLNSPPTAIIADTYIIWAVRVGTKRNIPVASF
WTTSATILSLFINSDLLASHGHFPIEPSESKLDEIVDYIPGLSPTRLSDLQILHGYSHQV
FNIFKKSFGELYKAKYLLFPSAYELEPKAIDFFTSKFDFPVYSTGPLIPLEELSVGNENR
ELDYFKWLDEQPESSVLYISQGSFLSVSEAQMEEIVVGVREAGVKFFWVARGGELKLKEA
LEGSLGVVVSWCDQLRVLCHAAIGGFWTHCGYNSTLEGICSGVPLLTFPVFWDQFLNAKM
IVEEWRVGMGIERKKQMELLIVSDEIKELVKRFMDGESEEGKEMRRRTCDLSEICRGAVA
KGGSSDANIDAFIKDITKIV

Other information
Ka divergence:0.0293733KaKs divergence:0.303906
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1368Length 2 (bp):1323Length divergence:-0.017
MFE 1 (kcal):-437.67MFE 2 (kcal):-406.05MFE divergence-0.037