Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G30730-AT2G30740
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.7696359754
Log2 mRNA fold difference:4.5111521349178
Log2 TE fold difference:-0.71542122720016
Sequences
Protein sequence

MFFFLVITYVANQKNQKPQDLAKPKEILPIIVPSLSVDEVNEQTDNFGPNSLIGEGSYGR
VYYATLNDGKAVALKKLDLAPEDETNTEFLSQVSMVSRLKHENLIQLVGYCVDENLRVLA
YEFATMGSLHDILHGRKGVQDALPGPTLDWITRVKIAVEAARGLEYLHEKVQPQVIHRDI
RSSNILLFDDYQAKIADFNLSNQSPDNAARLQSTRVLGSFGYYSPEYAMTGELTHKSDVY
GFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPKLSEDTVEECVDPKLKGEYSPKSVAKL
AAVAALCVQYESNCRPKMSTVVKALQQLLIATGSIPQF

MRRWICCGDKKGDSDLSNEEVHLKSPWQNSEANQKNQKPQAVVKPEAQKEALPIEVPPLS
VDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNTEFLNQVSMV
SRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLTRVKI
AVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLHSTRV
LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLS
EDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKPPAPAP
APVPES

Other information
Ka divergence:-0.8648KaKs divergence:-0.801295
GC content 1 (%):39GC content 2 (%):42GC content divergence:0.037
Length 1 (bp):1017Length 2 (bp):1101Length divergence:0.04
MFE 1 (kcal):-279.15MFE 2 (kcal):-314.66MFE divergence0.06