Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G30750-AT2G30770
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cytochrome P450, family 71, subfamily A, polypeptide 12
Function (paralog2):cytochrome P450, family 71, subfamily A, polypeptide 13

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.27027972137503
Log2 mRNA fold difference:-0.091464017943892
Log2 TE fold difference:-0.18338338055417
Sequences
Protein sequence

MSNIQEMEMILMVSLCLTTLITLFLLKQFLKRTANKVNLPPSPWRLPLIGNLHQLSLHPH
RSLHSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDLKFANRPRSKAVHGLMNGGR
DVVFGPYGEYWRQMKSVCILNLLTNKMVASFEKIREEELNEMIKKLEKASSSSSSENLSE
LFVTLPSDVTSRIALGRKHSEDETARDLKKRVRQIMELLGEFPIGDYVPALAWIDRINGF
NARIKEVSQGFSDLMDKVVQEHLEAGNHKEDFVDILLSIESEKSIGFQAQRDDIKFMILD
MFIGGTSTSSTLLEWIMTELIRNPNVMKKLQDEIRSTIRPHGSYIKEKDVENMKYLKAVI
KEVFRVHPPLPLILPRLLSEDVKVKGYNIAAGTEVIINAWAIQRDPAIWGPDAEEFKPER
HLDSTLDYHGKDLNFIPFGSGRRICPGINLALGLVEVTVANLVGRFDWRAEAGPNGDQPD
LTEAFGLDVCRKFPLIAFPSSVI

MSNIQEMEMILSISLCLTTLITLLLLRRFLKRTATKVNLPPSPWRLPVIGNLHQLSLHPH
RSLRSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDHKFANRPRSKAVHGLMNGGR
DVVFAPYGEYWRQMKSVCILNLLTNKMVESFEKVREDEVNAMIEKLEKASSSSSSENLSE
LFITLPSDVTSRVALGRKHSEDETARDLKKRVRQIMELLGEFPIGEYVPILAWIDGIRGF
NNKIKEVSRGFSDLMDKVVQEHLEASNDKADFVDILLSIEKDKNSGFQVQRNDIKFMILD
MFIGGTSTTSTLLEWTMTELIRSPKSMKKLQDEIRSTIRPHGSYIKEKEVENMKYLKAVI
KEVLRLHPSLPMILPRLLSEDVKVKGYNIAAGTEVIINAWAIQRDTAIWGPDAEEFKPER
HLDSGLDYHGKNLNYIPFGSGRRICPGINLALGLAEVTVANLVGRFDWRVEAGPNGDQPD
LTEAIGIDVCRKFPLIAFPSSVV

Other information
Ka divergence:0.0245614KaKs divergence:-0.569734
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1512Length 2 (bp):1512Length divergence:0
MFE 1 (kcal):-461.67MFE 2 (kcal):-456.81MFE divergence-0.005