Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G30860-AT2G30870
Species:Arabidopsis
Duplication type:TD
Function (paralog1):glutathione S-transferase PHI 9
Function (paralog2):glutathione S-transferase PHI 10

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.31143516886458
Log2 mRNA fold difference:-0.30089826197996
Log2 TE fold difference:-0.016266068380286
Sequences
Protein sequence

MVLKVYGPHFASPKRALVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGD
YKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFA
SVMGFPSDEKLIKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPIG
KAYMIKDRKHVSAWWDDISSRPAWKETVAKYSFPA

MVLTIYAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGD
YKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFA
PLMGFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIG
KAHLIKDRKHVSAWWDKISSRAAWKEVSAKYSLPV

Other information
Ka divergence:0.510211KaKs divergence:0.240252
GC content 1 (%):49GC content 2 (%):44GC content divergence:-0.054
Length 1 (bp):648Length 2 (bp):648Length divergence:0
MFE 1 (kcal):-216MFE 2 (kcal):-193.8MFE divergence-0.054