Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G31020-AT2G31030
Species:Arabidopsis
Duplication type:TD
Function (paralog1):OSBP(oxysterol binding protein)-related protein 1A
Function (paralog2):OSBP(oxysterol binding protein)-related protein 1B

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.4957956478582
Log2 mRNA fold difference:-3.2906039599339
Log2 TE fold difference:0.7828960915079
Sequences
Protein sequence

MYAATPETPFGSARSQPVITRSVSQRYNHPGQSNHHHLLHSLSFNHQNVLALPAAAREPP
VDVKINDIAGNSIAGILYKWVNYGKGWRPRWFVLQDGVLSYYKIKGPDKIVVIHETEKGS
RVIGEESTRMISRNKRHAATNNTNHQLRRKPFGEVHLKVSSIRESRSDDKRFSIFTGTKR
LHLRAETREDREAWIEALQAVKDMFPRMSNCELMAPTNNLDISIEKLRLRLVEEGVSESA
IQDCEQITRSEFSAIQSQLLLLKQKQWLLIDTLRQLETEKVDLENTVVDETQRQAGNGDS
EETISESDDDNEQFDEAEEEMDTCDSLSSSSFKSIGSVFRTSSFSSDDDGLTNGFESEND
DVDPSIKTIGFNYPHVKRRKKLPDPVEKEKSVSLWSMIKDNIGKDLTKVCLPVYFNEPLS
SLQKCFEDLEYSYLLDQASEWGKRGNNLMRILNVAAFAVSGYASTEGRICKPFNPMLGET
YEADYPDKGLRFFSEKVSHHPMIVACHCDGTGWKFWGDSNLKSKFWGRSIQLDPIGLLTL
QFDDGEIVQWSKVTTSIYNLILGKLYCDHYGTMKIEGNGEYSCKLKFKEQSMIDRNPHQV
QGIVEDKNGKTVARLFGKWDESIHYVMVDQGKVNESHLLWKRNKQPENPTKYNLTRFGIT
LNELTPGLKEKLPPTDSRLRPDQRYLEKGEYEMGNAEKLRLEQRQRQAREMQERGWKPKW
FRKEKGSETYRYIGGYWEARDSGSWDDCPDIFGQVHQSIK

MEARVISCTTFGDNKVVKIAVLNHQAITKYKAGENETTVVVSDDTCPEKDVKEIKKFCEK
LGYVYEGRLSEEYTQTNTGPDDDWITNGFESDDDVDPSIKTIGFNYPHVNRRNKLPDPVE
KEKSVSLWSMIKDNIGKDLTKVCLPVYFNEPLSSLQKCFEDLEYSYLLDQASEWGKRGNN
LMRILNVAAFAVSGYASTKGRICKPFNPMLGETYEADYPDKGLRFFSEKVSHHPMIVACH
CDGTGWKFWGDSNLKSKFWGRSIQLDPIGLLTLQFDDGEIVQWSKVTTSIYNLILGKLYC
DHYGTMLIEGNGEYSCKLKFKKQSMMDRNPHQVQGIVEDKNGKTVAKLFGKWDESMYYVM
VNQGKESESHLLWKRNKPLENPTKYNLTRFGITLNELTPDLKEMLPPTDSRLRPDQRYLE
KGEFEMGNREKLRLEQRQRQAREKQERGWKPTWFSKEKGSETYRYIGGYWEARDSGRWDD
CPDIFGQVH

www.000webhost.com

Other information
Ka divergence:0.812264KaKs divergence:-0.0999021
GC content 1 (%):42GC content 2 (%):39GC content divergence:-0.037
Length 1 (bp):2283Length 2 (bp):1470Length divergence:-0.217
MFE 1 (kcal):-648.75MFE 2 (kcal):-391.33MFE divergence-0.248