Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G31083-AT2G31085
Species:Arabidopsis
Duplication type:TD
Function (paralog1):CLAVATA3/ESR-RELATED 5
Function (paralog2):CLAVATA3/ESR-RELATED 6

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.72708828465725
Log2 mRNA fold difference:-0.98988947248922
Log2 TE fold difference:-0.63849815055954
Sequences
Protein sequence

MATLILKQTLIILLIIFSLQTLSSQARILRSYRAVSMGNMDSQVLLHELGFDLSKFKGHN
ERRFLVSSDRVSPGGPDPQHH

MANLILKQSLIILLIIYSTPILSSQARILRTYRPTTMGDMDSQVLLRELGIDLSKFKGQD
ERRFLVDSERVSPGGPDPQHH

www.000webhost.com

Other information
Ka divergence:0.329688KaKs divergence:0.99923
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):246Length 2 (bp):246Length divergence:0
MFE 1 (kcal):-54.8MFE 2 (kcal):-66.99MFE divergence0.1