Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G31865-AT2G31870
Species:Arabidopsis
Duplication type:TD
Function (paralog1):poly(ADP-ribose) glycohydrolase 2
Function (paralog2):Poly (ADP-ribose) glycohydrolase (PARG)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.65023386815951
Log2 mRNA fold difference:-0.49699530055242
Log2 TE fold difference:-0.17507494693432
Sequences
Protein sequence

MELRADLRSILQYLPLVAQSSSLVWPPSVEEELQTISRGPSESMVNSGEALALHITNMRK
SLSLNASDLAPYALQGYGLFFDKKISREESANFFGEVVPALCRLLLQLPSMLEKHYQKAD
HVLDGVKSGLRLLGPQEAGIVLLSQELIAALLACSFFCLFPEVDRSLKNLQGINFSGLFS
FPYMRHCTKQENKIKCLIHYFGRICRWMPTGFVSFERKILPLEYHPHFVSYPKADSWANS
VTPLCSIEIHTSGAIEDQPCEALEVDFADEYFGGLTLSYDTLQEEIRFVINPELIAGMIF
LPRMDANEAIEIVGVERFSGYTGYGPSFQYAGDYTDNKDLDIFRRRKTRVIAIDAMPDPG
MGQYKLDALIREVNKAFSGYMHQCKYNIDVKHDPEASSSTKIKFVFAKQHVPLTSDSASQ
VIESSHRWCIDHEEKKIGVATGNWGCGVFGGDPELKIMLQWLAISQSGRPFMSYYTFGLQ
ALQNLNQVIEMVALQEMTVGDLWKKLVEYSSERLSRRTWLGFFSWLMTSLST

MENREDLNSILPYLPLVIRSSSLYWPPRVVEALKAMSEGPSHSQVDSGEVLRQAIFDMRR
SLSFSTLEPSASNGYAFLFDELIDEKESKRWFDEIIPALASLLLQFPSLLEVHFQNADNI
VSGIKTGLRLLNSQQAGIVFLSQELIGALLACSFFCLFPDDNRGAKHLPVINFDHLFASL
YISYSQSQESKIRCIMHYFERFCSCVPIGIVSFERKITAAPDADFWSKSDVSLCAFKVHS
FGLIEDQPDNALEVDFANKYLGGGSLSRGCVQEEIRFMINPELIAGMLFLPRMDDNEAIE
IVGAERFSCYTGYASSFRFAGEYIDKKAMDPFKRRRTRIVAIDALCTPKMRHFKDICLLR
EINKALCGFLNCSKAWEHQNIFMDEGDNEIQLVRNGRDSGLLRTETTASHRTPLNDVEMN
REKPANNLIRDFYVEGVDNEDHEDDGVATGNWGCGVFGGDPELKATIQWLAASQTRRPFI
SYYTFGVEALRNLDQVTKWILSHKWTVGDLWNMMLEYSAQRLYKQTSVGFFSWLLPSLAT
TNKAIQPP

www.000webhost.com

Other information
Ka divergence:-0.360834KaKs divergence:0.19061
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1599Length 2 (bp):1647Length divergence:0.015
MFE 1 (kcal):-483.9MFE 2 (kcal):-486.18MFE divergence0.002