Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G32020-AT2G32030
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Acyl-CoA N-acyltransferases (NAT) superfamily protein
Function (paralog2):Acyl-CoA N-acyltransferases (NAT) superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.62820447168638
Log2 mRNA fold difference:-0.89581242238797
Log2 TE fold difference:1.6300116692148
Sequences
Protein sequence

MEMDSEETNPIMSSSPPGRISLRPMTLSDVDDYMVWATDPKVARFCTWEPCTSRDEAIKY
ITDRVLTHPWLRAICLEDDRPIGYILIMAVDNIRKEIGYVLARKYWGKGFATEAVRLVTA
EVFEEFPEIERLEALVDVDNVGSQRVLEKVGFTREGVMRKFICIKGSVRDTVMFSFLSTD
TLK

MEMDSTTTIKPETLSTVSSSPPEKIHLRPMTLSDVDDFMVWATDSNVTRFCTWEPYTSRE
AAIAYLNDALLPHPWLRAICLDNDRPIGSISVTPVDEIRGEIGYVLGSKYWGKGIATEAV
RLVAGEIFKEKPEMQRLEALVDVDNVGSQKVLEKVGFVKEGVMRKFMYLKGNVRDMVMFS
FLPSDSLH

Other information
Ka divergence:-0.0878479KaKs divergence:-0.298294
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):552Length 2 (bp):567Length divergence:0.013
MFE 1 (kcal):-153.7MFE 2 (kcal):-174.92MFE divergence0.065