Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G32160-AT2G32170
Species:Arabidopsis
Duplication type:TD
Function (paralog1):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Function (paralog2):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.83027537676549
Log2 mRNA fold difference:-1.0193336491206
Log2 TE fold difference:0.1695713894165
Sequences
Protein sequence

MISSSEMMATEKAPEFVTAMATETERIGNSREVDEEKISRKKNPEEEALEAKCLPGIISA
YLNYPKAAEENLKKCERSYQKLSPAHKALVTHFPMKLQRLRRCILMNSHFIYNMLQAFEP
PIDLSKHMREPITGALSMEELQREEHHHDHSLKNAEIRLNNKTCEFDGGHLNHDHGSVPF
SSHDWLDSSLQAHVPLVDVNKVRWVIRNIVRDWGAEGQRERDECYKPILEELDSLFPDRH
KESTRPACLVPGAGLGRLALEISCLGFRSQGNEVSYYMMLCSSFILNYTQLPGEWTIYPW
IHTNCNSLSDDDQLRPISIPDIHPASAGVTESFSMCRGDFVEVFNESSQAGMWDAVVTCF
FIDTAHNIIEYIETISKILKDGGVLINLGPLLYHFADEQGLENEMSIELSLEDVKRVASH
YGFEMEKEKTIETTYSTNPRSMMKNRYYPVFWTMRKKCAITTT

MVSPSEMTETAPAIMTTESERIESSRELVDNEEEEKIRRQKKLEEALEAKSLRRIISAYL
NYPEASEEDLKRWERSYRKLSPAHKALVPHYPMKFQRLRRCISANSYFIFNMLQAFEPPI
DLSQELDGCEDSNLDCAPHERYTLDERHDSSCQPALTNSCTYKEESKHIRDPITGVSIEE
LQRKEAHDHSPKDDSADTRINDKTCDCHEGQLNHDHGSVSFSSHDWLDSSLQTHVPLVDV
DKRETKIIMCHVRTYSQSLLVPLGSLVSYEGWFAHVALHGEVNPVELKCTFLHVRCIIRN
IVRDWAAEGQRERDQCYKPILEELDSLFPDRLKESTCCIHSPYKVDYMICSTPPACLVPG
AGLGRLALEISCLGFISQGNEFSYYMMICSSFILNYTQVPGEWTIYPWIHSNCNSLSDND
QLRPIAIPDIHPASAGITEGFSMCGGDFVEVYNESSHAGMWDAVVTCFFIDTAHNVIEYI
QTISKILKDGGVWINLGPLLYHFADTYGHENEMSIELSLEDVKRVASHFGFVIEKERTIE
TTYTTNPRAMMQNRYYTAFWTMRKKCAITTT

www.000webhost.com

Other information
Ka divergence:-0.438703KaKs divergence:-0.299393
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1392Length 2 (bp):1716Length divergence:0.104
MFE 1 (kcal):-399.81MFE 2 (kcal):-501.51MFE divergence0.113