Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G32190-AT2G32200
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.058449549924129
Log2 mRNA fold difference:1.6266211860729
Log2 TE fold difference:-2.2748431424807
Sequences
Protein sequence

MSQYSQNQSSGAYPTPPVSTGPYMTPPPLGYPTSDISHATVAPVETKSKGDGFLKGCLAA
MCCCCVLDACF

MSQYSQNQYAGAYPTPPVSTGPYVAPPPLGYPTNDTTHATVAPVETKSKGEAADGFLKGC
LATMLACCVLDACIF

Other information
Ka divergence:-1KaKs divergence:0.314863
GC content 1 (%):55GC content 2 (%):53GC content divergence:-0.019
Length 1 (bp):216Length 2 (bp):228Length divergence:0.027
MFE 1 (kcal):-69.4MFE 2 (kcal):-67.6MFE divergence-0.013