Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G32530-AT2G32540
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cellulose synthase-like B3
Function (paralog2):cellulose synthase-like B4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.8997813612341
Log2 mRNA fold difference:1.9143086011595
Log2 TE fold difference:-0.28165114947206
Sequences
Protein sequence

MADSSSSLPPLCEKISYKNYFLRVVDLTILGFLFSLLLYRILLMNQNNSVWVVAFLCESF
FSFIWLLITSIKWSPASYKSYPERLDERVHDLPSVDMFVTTADPVREPPILVANTLLSLL
AVNYPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNIKVRAPFRYFLNPPAA
TESSEFSKDWEITKREYEKLSRRVEDATGDSHWLDAEDDFEDFSNTKPNDHSTIVKVVWE
NKGGVGVENEVPHFVYISREKRPNYLHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYAN
EADVVRQAMCIFLQKSMNSNHCAFVQFPQEFYDSNADELTVLQSYLGRGIAGIQGPTYAG
SGCFHTRRVMYGLSIDDLEDDGSLSSLATRKYLAEENLAREFGNSNEMVTSVVEALQRKP
NPQNTLANSLEAAQEVGHCHFEYQTSWGKTIGWLYESTAEDANTSIGIHSRGWTSSYISP
KPPAFLGAMPPGGPEAMLQQRRWATGLLEVLFNKQSPLIGMFCRKIRFRQSLAYLYIFTW
GLRSIPELIYCLLPAYCLLHNAALFPKGVYLGIVVTLVGMHCLYSLWEFMSLGFSVQSWF
ASQSFWRIKTTCSWLFSIPDIILKLLGISKTVFIVTKKTMPKTMSGSGSEKSQREVDCPN
QDSGKFEFDGSLYFLPGTFILLVNLAALAGCSVGLQRHRGGGSGLAEACGCILVVILFLP
FLKGMFEKGKYGIPWSTLSKAAFLAVLFVVFSVGN

MAESSSPLPPLCERISHKSYFLRAVDLTILGLLLSLLLYRILHVNQKDTVWIVAFLCETC
FTFVWLLITNIKWSPADYKTYPERLDERVHELPPVDMFVTTADPVREPPLIVVNTVLSLL
AVNYPANKLACYVSDDGCSPLTYFSLKEASKFAKIWVPFCKKYNVRVRAPFMYFRNSPEA
AEGSEFSKDWEMTKREYEKLSQKVEDATGSSHWLDAEDDFEAFLNTKSNDHSTIVKVVWE
NKGGVGDEKEVPHVVYISREKRPNHFHHYKAGAMNFLVRVSGLMTNAPYMLNVDCDMYVN
EADVVRQAMCIFLQKSMDSNHCAFVQYPQDFYDSNVGELTVLQLYLGRGIAGIQGPQYAG
SGCFHTRRVMYGLSLDDLGDDGSLSSIATRKYLAEESLTREFGNSKEMVKSVVDALQRKP
FPQKNLKDSLETAQEMGHCHYEYQTSWGKNIGWLYDSTTEDVNTSIGIHSRGWTSSYIFP
DPPAFLGCMPQGGPEVMVQQRRWATGLLEILFNKQSPLIGMFCRKIRFRQSLAYLYVFSW
GLRSIPELFYCLLPAYCLLHNSALFPKGVYLGIIITLVGIHCLYTLWEFMNLGFSIQSWY
VTQSFGRIKTTCSWLFSVLDVILKLLGISKTVFIVTKKTMPETKSGSGSKKSQREVDCPN
QDSGKFEFDGSLYFLPGTFIVLVNLAALAGCLVGLQSRGGGGSGLAEACGCILVVILFLP
FLKGMFEKGKYGIPFSTLSKAAFLAALFVVLSVGN

www.000webhost.com

Other information
Ka divergence:-0.37009KaKs divergence:0.116641
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):2268Length 2 (bp):2268Length divergence:0
MFE 1 (kcal):-664.99MFE 2 (kcal):-659.89MFE divergence-0.004