Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G33590-AT2G33600
Species:Arabidopsis
Duplication type:TD
Function (paralog1):NAD(P)-binding Rossmann-fold superfamily protein
Function (paralog2):NAD(P)-binding Rossmann-fold superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.89910032262486
Log2 mRNA fold difference:0.26605500529938
Log2 TE fold difference:-1.1876627002758
Sequences
Protein sequence

MADVHKGKVCVTGAGGFLGSWVVDLLLSKDYFVHGTVRDPDNEKYAHLKKLEKAGDKLKL
FKADLLDYGSLQSAIAGCSGVFHVACPVPPASVPNPEVELIAPAVDGTLNVLKACIEANV
KRVVYVSSVAAAFMNPMWSKNQVLDEACWSDQEYCKKTENWYCLAKTRAESEAFEFAKRT
GLHLVSVCPTLVLGPILQQNTVNASSLVLLKLLKEGFETRDNQERHLVDVRDVAQALLLV
YEKAEAEGRYICTSHTVKEEIVVEKLKSFYPHYNYPKKYIDAEDRVKVSSEKLQKLGWTY
RPLEETLVDSVESYRKAKLVD

MAVVQKGKVCVTGAGGFLGSWVVNHLLSRDYFVHGTVRDPGNEKYAHLKKLDKAGDKLKL
FKADLLNYGSLQSAIAGCSGVFHVACPVPSASVPNPEVDLIAPAVDGTLNVLKACVEAKV
KRVVYVSSVSAVAMNPMWSKSQVLDETAWSDQDYCKKTENWYSLSKTRAESEAFEFAKRT
GLDLVSVCPTLVLGPVLQQHTVNASSLVLLKLLKEGYESRNNQERHLVDVRDVAQALLLV
YEKAEAEGRYICIGHTVREQEVAEKLKSLYLNYNYPKRYIEADGKVKVSSEKLQKLGWTY
RPLEETLVDSVESYRKAKLVD

www.000webhost.com

Other information
Ka divergence:0.233154KaKs divergence:-0.855787
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):966Length 2 (bp):966Length divergence:0
MFE 1 (kcal):-295.7MFE 2 (kcal):-301.47MFE divergence0.01