Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G34350-AT2G34355
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Nodulin-like / Major Facilitator Superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.4106773452175
Log2 mRNA fold difference:0.46827276482285
Log2 TE fold difference:1.3001248783133
Sequences
Protein sequence

MEFANTKWVAAAASIWIQSFSGASYTFGIYSSVLKSSQSYDQSTLDTVSVYKDIGANVGI
LSGLFYTAVASRKSGNGGFFSGPWLVIFVGLLQWFVGYGFIWMATSGVIPRPPVAMMCLF
MFFAGHCQPFFNTAIVVTAVRNFSDYGGTAVGIMKGYLGLSGAILVQMYHIFCGGDPRNY
ILLLAVVPSLLILTLMPFVRTYDTVIAGDKKHLNGLSAISLIIVTYLMVVILVENIIGMS
MPMKICSFTFLLLLLASPLLVAVRAQREEEHRFLSLDFPVTERTTLLDSPKLNSSSDVKD
VMTNDMNVLEAICTTNFWLLFVAMICGMGSGLATINNIRQMGESLRYSTVQLNSLVSLWS
IWNFLGRFGSGYISDTYLHSHGWPRPVFMAITLGLMAIGHIVMASGLLGSLYIGSLLVGL
AYGSQWSLMPTITSEIFGVLHMGTIFYTISIASPVGSYFFSVKVIGYLYDKVASEDDHSC
YGNHCFRTSFLIMAAMALLGSLVALVLLLRTKKFYATLVAKRILK

MERINTKWVAAAASIWIQSFSGATYTFAIYSSILKSSQSYDQSTLDFVSVFKDIGGTFGI
ISGFLYTAMTSKSRGFGGPWVVVFVGLVQWFVGFFFIWASVVGLIAPPPVPLMCLFVFLA
GHSLPFFNTANVVTAARNFSQYGGTAVGIMQGFLGLSGAILIQLYHAVCGGEGNPATFIL
LLAIVPTLVMFLAMPFVRVYETVTISDKKHLDGLSAISMIIAAYLMVVITVENVLGLSRS
MQIFSFILVLLLLASPLLVAVRALREKRQTLSSLDGPVLDTSALLDPPSSNIFPDGDHLV
AEDSNILEAMSTVNFWLLFLAMLCGMGSGFATVNNMRQIGESLRYSSVQLNSLVSLWSIW
NFLGRFGAGYVSDTFLHKHSWPRPIFMAITLGVMAIGHIIVASGVQGSLYAGSVLIGMAY
GSQWSLMPTITSEIFGIRHMGTIYFTISIAGPIGSYILSVKVIGYFYDKVASEDDNSCFG
SQCFRTSFMIMASVALFGSLVASVLFFRTHKFYKNLVAKRNLK

Other information
Ka divergence:-0.0285854KaKs divergence:0.0375979
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1578Length 2 (bp):1572Length divergence:-0.002
MFE 1 (kcal):-489.94MFE 2 (kcal):-481.91MFE divergence-0.008