Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G34420-AT2G34430
Species:Arabidopsis
Duplication type:TD
Function (paralog1):photosystem II light harvesting complex gene B1B2
Function (paralog2):light-harvesting chlorophyll-protein complex II subunit B1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.99315836823476
Log2 mRNA fold difference:-0.45826951965325
Log2 TE fold difference:-0.48384017277297
Sequences
Protein sequence

MASSTMALSSPAFAGKAVKPAASDVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPF
SGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARN
GVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGDGP
LGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLE
NLADHLADPVNNNAWAFATNFVPGK

MAASTMALSSPALTGKAVKLSPAASEVFGTGRITMRKASKPTGPSGSPWYGSDRVKYLGP
FSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLAR
NGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGDG
PLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPL
ENLADHLADPVNNNAWAFATNFVPGK

www.000webhost.com

Other information
Ka divergence:-0.348929KaKs divergence:-0.319188
GC content 1 (%):57GC content 2 (%):56GC content divergence:-0.009
Length 1 (bp):798Length 2 (bp):801Length divergence:0.002
MFE 1 (kcal):-309.9MFE 2 (kcal):-314.73MFE divergence0.008