Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G34490-AT2G34500
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cytochrome P450, family 710, subfamily A, polypeptide 2
Function (paralog2):cytochrome P450, family 710, subfamily A, polypeptide 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-3.5500614180504
Log2 mRNA fold difference:-2.9951728955438
Log2 TE fold difference:-0.52796621615673
Sequences
Protein sequence

MVFSVSIFASLAPYLVSALLLFFLIEQLSYLVKKRNLPGPLFVPPIIGNAISLVRDPTSF
WFKQSDTAGTSPGLAANYLIGKFIIYIRDTELSHQIFSNVRLEAFHPLGHPFGKQLFGDH
SLIYLFGEDHKTVRRHLAPNFTPKALSTYSDLQQIVMLRHLRQWEESFSGGTKPVSMRDL
VRELNLETSQTVFVGPYLDKEARNTFCTDYNLFNLGSMALPINLPGFAFNKARRAVMNLE
KTLSVCAGKSKKRMATGEEPTCLIDFWMHAFVTEIESGNPPPLHSEDEAIGGLLFDFLFA
AQDASTSSLLWAVTFLESHPKVLSKVREEVAKIWSPQSGHLITADQLAEMKYTRAVAREV
VRYRPPATMVPHIATNDFPLTESYTIPKGTIVFPSVFDASFQGFTEPNRFDPDRFSETRQ
EDQVFKRNYLAFGWGAHQCVGQRYALNHLVLFIAMFSSLFDFKRLQSDGCDDIIYCPTIS
PKDGCTVFLSKRIVTYPNL

MVFSVSIFASLAPYLISAFLLFLLVEQLSYLFKKRNIPGPFFVPPIIGNAVALVRDPTSF
WDKQSSTANISGLSANYLIGKFIVYIRDTELSHQIFSNVRPDAFHLIGHPFGKKLFGDHN
LIYMFGEDHKSVRRQLAPNFTPKALSTYSALQQLVILRHLRQWEGSTSGGSRPVSLRQLV
RELNLETSQTVFVGPYLDKEAKNRFRTDYNLFNLGSMALPIDLPGFAFGEARRAVKRLGE
TLGICAGKSKARMAAGEEPACLIDFWMQAIVAENPQPPHSGDEEIGGLLFDFLFAAQDAS
TSSLLWAVTLLDSEPEVLNRVREEVAKIWSPESNALITVDQLAEMKYTRSVAREVIRYRP
PATMVPHVAAIDFPLTETYTIPKGTIVFPSVFDSSFQGFTEPDRFDPDRFSETRQEDQVF
KRNFLAFGWGPHQCVGQRYALNHLVLFIAMFSSLLDFKRLRSDGCDEIVYCPTISPKDGC
TVFLSRRVAKYPNFS

www.000webhost.com

Other information
Ka divergence:-0.323109KaKs divergence:-0.296233
GC content 1 (%):49GC content 2 (%):51GC content divergence:0.02
Length 1 (bp):1500Length 2 (bp):1488Length divergence:-0.004
MFE 1 (kcal):-471.34MFE 2 (kcal):-468.92MFE divergence-0.003