Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G34790-AT2G34810
Species:Arabidopsis
Duplication type:TD
Function (paralog1):FAD-binding Berberine family protein
Function (paralog2):FAD-binding Berberine family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.36163506764151
Log2 mRNA fold difference:0.32162978504605
Log2 TE fold difference:-0.62804720800167
Sequences
Protein sequence

MAFAISKRNATLFLVTLLLISVPLSSSTLQQDFVKCLVDNSDVSFPITASFFSPDQNATL
FKEELESTAQNLRYLTPSNPKPVFIFEPLYETHVQAAVVCAKKLQLHLRLRSGGHDYEGL
SFVAEDETPFVIVDLSKLRQVDVDLDSNSAWAHAGATIGEVYYRIQEKSQTHGFPAGLCS
SLGIGGHLVGGAYGSMMRKFGLGADNVLDARIVDANGQILDRAAMGEDVFWAIRGGGGGS
FGVILAWKIKLVPVPATVTVFTVTKTLEQDGTKVLYKWEQIADKLDDDLFIRVIISPASK
TTKPGNRTISMSYQAQFLGDSNRLLQVMQKSFPELGLTKKDCTEMSWIKSVMYIAGFPNS
AAPEALLAGKSLFKNHFKAKSDFVKEPIPVEGLEGLWERFLEEDSPLTIWNPYGGMMSRI
SESEIPFPHRNGTLFKIQWLSTWQDGKVSEERHMKWIREMYSYMEQYVSKNPRQAYVNYR
DLDLGTNEGETDAREWGAKYYKGNFERLVKIKGEFDPDNFFRHEQSVPTKIG

MKFWSRPLTFLIIIIYLIIQQVNSSPPSLSIPEHFLRCLDTQPSDHGSPNSRTAVIPTNS
SFSTNLMNGVRNLRFASVSTRKPEVIVAAVTETHIRATISCCKLLNLELRIRSGGHDYEG
FSYTSPVPFVILDMYNFNKIDINMKDETVWIQSGASLGQLYYNIASKSKVHAFPAGVCPK
VGAGGHFSGGGFGNLMRKYGLSIDHIIDAQIMDANGKVYRNRQAMGEDVFWAIRGGGGGS
YGVILAWKIKLVRVPEKVTVFKLERTVREGAVDLVHKWQQVAPVIDRDLFIRLEIKPINR
KISKGKTIKVSFIGMFLGLPERLLNITKQSFPELHLTKEDCMVKKWIESSVFWANYPEKA
PIELLLKRVSTNEYYWKRTSDFVQAPISKQGLAKIFQTMIDHSPLPRRVWMQWNPWGGKM
AEIASDATAFVHRGGNVFMIEHFMNWYRPGDELEEKFLAIARSFKEAMAPFVSKNPREAF
FNYRDVDIGITTPGYNATYEGAKVYGDSYFKGNYLRLVKIKARFDRTNFFRSQQGIPVLA

Other information
Ka divergence:-0.0659523KaKs divergence:-0.729537
GC content 1 (%):48GC content 2 (%):43GC content divergence:-0.055
Length 1 (bp):1599Length 2 (bp):1623Length divergence:0.007
MFE 1 (kcal):-512MFE 2 (kcal):-468.49MFE divergence-0.044